Recombinant Drosophila melanogaster Putative gustatory receptor 59c (Gr59c)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bitter Taste Coding

Gr59c is expressed in taste neurons of the labral sense organ (LSO) and I-a sensilla, where it modulates responses to aversive compounds . Key findings include:

  • Suppression of Bitter Responses: In I-a sensilla, Gr59c inhibits responses to caffeine (CAF), coumarin (COU), theobromine (THE), and umbelliferone (UMB) by competing with other Grs for co-receptor binding . Deletion of Gr59c converts I-a response profiles to resemble I-b sensilla, which lack Gr59c .

  • Receptor Complexes: Gr59c forms heteromultimers with Gr32a and Gr66a to detect lobeline (LOB), denatonium (DEN), and berberine (BER) . Distinct complexes (e.g., Gr59c/Gr32a/Gr66a vs. Gr22e/Gr32a/Gr66a) enable detection of non-overlapping bitter compounds like strychnine .

  • Evolutionary Divergence: The Gr59c gene contributes to species-specific bitter coding. In D. melanogaster, it collaborates with Gr32a and Gr89a to suppress CAF responses, a feature absent in related Drosophila species .

3.1. Genetic and Physiological Analyses

  • Knockout Studies: Gr59c deletion increases sensitivity to LOB, DEN, and BER in I-a sensilla while reducing suppression of other bitter responses .

  • Ectopic Expression: Misexpressing Gr59c in I-b sensilla alters their response profile to mimic I-a, confirming its inhibitory role .

  • Ligand Specificity: Gr59c does not respond to sweet tastants (e.g., fructose) but is critical for bitter compound detection .

3.2. Mechanistic Insights

  • Competitive Binding Model: Gr59c competes with other Grs for co-receptors, limiting their ability to form alternative complexes .

  • Collaborative Suppression: Gr59c works with Gr32a and Gr89a to inhibit CAF responses in I-a neurons, requiring four Grs (Gr39a.a, Gr33a, Gr66a, Gr93a) for phenotypic switching .

Applications in Entomology and Neuroscience

  • Behavioral Studies: Used to map bitter receptor-to-neuron connectivity via GAL4/UAS systems .

  • Evolutionary Biology: Highlights how Gr gene diversification enables adaptation to new toxins .

  • Drug Discovery: Serves as a model for studying insect repellents targeting gustatory pathways .

Limitations and Future Directions

  • Partial Protein Structure: Current recombinant Gr59c lacks full-length sequence data, limiting structural studies .

  • Underexplored Interactions: The role of ionotropic receptors (Irs) and pickpocket receptors (Ppks) in Gr59c-mediated signaling remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gr59c; GR59D.2; CG30186; Putative gustatory receptor 59c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr59c
Target Protein Sequence
MVDLVKTILLIAYWYGLAVGVSNFEVDWLTGEAIATRRTTIYAAVHNASLITLLILFNLG NNSLKSEFISARYLHEYFFMLMTAVRISAVLLSLITRWYQRSRFIRIWNQILALVRDRPQ VVRGRWYRRSIILKFVFCVLSDSLHTISDVSAQRKRITADLIVKLSLLATLTTIFNMIVC QYYLAMVQVIGLYKILLQDLRCLVRQAECICSIRNRRGGVYSIQCCSLADQLDLIAERHY FLKDRLDEMSDLFQIQSLSMSLVYFFSTMGSIYFSVCSILYSSTGFGSTYWGLLLIVLST ASFYMDNWLSVNIGFHIRDQQDELFRVLADRTLFYRELDNRLEAAFENFQLQLASNRHEF YVMGLFKMERGRLIAMLSSVITHTMVLVQWEIQNDES
Uniprot No.

Target Background

Function

Probable gustatory receptor mediating acceptance or avoidance behavior depending on its substrates.

Database Links

KEGG: dme:Dmel_CG30186

STRING: 7227.FBpp0071887

UniGene: Dm.26380

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed is restricted to taste hairs in the labial palps. In larva, is expressed in neurons of the terminal external chemosensory organ.

Q&A

What are gustatory receptors in Drosophila melanogaster?

Gustatory receptors (GRs) in Drosophila melanogaster are a family of membrane proteins that play crucial roles in the detection of tastants. These receptors are expressed in gustatory receptor neurons (GRNs) and are essential for various behaviors including feeding, mating, and avoidance of toxic compounds. The Drosophila genome contains approximately 68 GR genes that encode diverse receptor proteins with varying taste specificities . These receptors are structurally distinct from mammalian taste receptors and form a unique insect-specific chemosensory receptor family. GRs function in multiprotein complexes, with different combinations of receptors detecting different tastants, allowing flies to discriminate between beneficial and harmful compounds.

What are the major taste modalities detected by Drosophila gustatory receptors?

Drosophila gustatory receptors mediate the detection of multiple taste modalities, including sweet, bitter, salty, and potentially umami tastes. Most aversive tastants are thought to be detected through members of the GR family . Specific GRs have been characterized for their roles in detecting particular compounds. For example, GR8a, GR66a, and GR98b function together in detecting L-canavanine, a plant-derived insecticide that triggers aversive behavior . Similarly, GR66a and GR93a are required specifically for the avoidance of caffeine, while GR32a is involved in inhibiting male-male courtship behaviors . This specialized detection system allows flies to evaluate food quality and avoid potentially toxic substances, which is critical for survival.

What is known about the functional role of Gr59c?

While specific information about Gr59c's function is not directly addressed in the provided search results, we can infer from studies of other gustatory receptors that Gr59c likely contributes to a specific chemosensory response in Drosophila. Based on the pattern observed with other GRs, Gr59c may function in combination with other receptors rather than independently. For example, the detection of L-canavanine requires the co-expression of three receptors: GR8a, GR66a, and GR98b . Similarly, Gr59c might be part of a multiprotein complex that detects specific compounds or classes of compounds. Its precise role would need to be determined through functional studies comparing wild-type and Gr59c mutant flies.

How might Gr59c interact with other gustatory receptors?

Studies of other GRs suggest that Gr59c likely works in concert with other receptors. For instance, ectopic co-expression of Gr8a and Gr98b in Gr66a-expressing bitter-sensing neurons confers responsiveness to L-canavanine . Furthermore, misexpression of all three GRs enables salt- or sweet-sensing GRNs to respond to L-canavanine . These findings demonstrate that multiple GRs collaborate to produce functional taste receptors. By analogy, Gr59c might form heteromeric complexes with other GRs to create functional taste receptors with specific ligand sensitivities. The particular GRs that interact with Gr59c would need to be identified through co-expression studies and electrophysiological recordings.

In which tissues and cell types might Gr59c be expressed?

Based on expression patterns of other GR genes, Gr59c is likely expressed in a subset of gustatory receptor neurons. Most GR genes are expressed in a very small fraction (1%-4%) of gustatory sensilla in spatially restricted regions of the fly, while some are expressed in about 20% of sensilla distributed across all major gustatory organs . These organs include the labellum, legs, anterior wing margin, and internal pharyngeal taste organs like the labral sense organ (LSO) . Expression analysis using GAL4 reporter gene assays would be needed to determine the specific expression pattern of Gr59c. Each sensillum typically contains multiple gustatory neurons, but studies have shown that individual neurons generally express only a single GR gene .

What molecular techniques are suitable for recombinant Gr59c expression?

For recombinant expression of Gr59c, researchers typically use several complementary approaches. The gene can be cloned into expression vectors with tissue-specific promoters for in vivo studies in transgenic flies. For in vitro studies, Drosophila S2 cells provide an effective system for heterologous expression, as demonstrated with GR8a, GR66a, and GR98b, which induced an L-canavanine-activated nonselective cation conductance when co-expressed in these cells . To enable protein detection, Gr59c can be tagged with epitopes like HA or FLAG, or fluorescent proteins such as GFP. Codon optimization may improve expression efficiency, particularly in non-Drosophila expression systems. The choice of expression system should be guided by the specific research questions being addressed.

How can Gr59c function be assessed in vivo?

Functional analysis of Gr59c in vivo can be accomplished through behavioral assays, electrophysiological recordings, and calcium imaging. Behavioral assays typically involve preference or avoidance tests using wild-type flies versus flies with Gr59c mutations or targeted Gr59c expression in specific neurons. Electrophysiological recordings from taste sensilla can directly measure neuronal activity in response to potential Gr59c ligands. Modern approaches also include the use of genetically encoded calcium indicators (GECIs) like GCaMP to visualize neuronal activation in response to tastants. CRISPR-Cas9 gene editing can be used to generate Gr59c knockout flies for loss-of-function studies, while the GAL4-UAS system allows for targeted expression of Gr59c in specific cell types for gain-of-function experiments.

What imaging techniques are most effective for visualizing Gr59c expression?

Visualization of Gr59c expression can be achieved through several complementary techniques. Immunohistochemistry using antibodies against Gr59c (if available) or against epitope tags on recombinant Gr59c can reveal protein localization at the cellular and subcellular levels. The GAL4-UAS system with UAS-mCD8::GFP can be used to visualize the morphology of Gr59c-expressing neurons . Confocal microscopy is particularly useful for examining Gr59c expression in taste sensilla and tracing projections of Gr59c-expressing neurons to the subesophageal ganglion in the fly brain, where taste information is processed. Dual-labeling experiments with markers for neuronal subtypes (using anti-Elav antibodies) can confirm the neuronal identity of Gr59c-expressing cells, as has been done with other GR genes .

How can Gr59c be used in neural circuit mapping studies?

Gr59c can serve as a valuable tool for neural circuit mapping in Drosophila. By creating Gr59c-GAL4 driver lines, researchers can express neural tracers, calcium indicators, or optogenetic tools specifically in Gr59c-expressing neurons. This approach allows for visualization of the projection patterns of these neurons in the central nervous system, particularly in the subesophageal ganglion where gustatory neurons project . Trans-synaptic tracers can identify second-order neurons that receive input from Gr59c-expressing cells. Combined with behavioral assays, circuit mapping can establish causal relationships between Gr59c-expressing neurons and specific behaviors. The spatial organization of Gr59c projections can be compared with projections of other GR-expressing neurons to understand the topographic organization of taste information in the fly brain.

What are potential applications for Gr59c in taste perception research?

Research on Gr59c could significantly advance our understanding of taste perception mechanisms in insects. By identifying the ligands that activate Gr59c and the behavioral responses they elicit, researchers can gain insights into how specific chemical structures are recognized by insect taste receptors. Comparative studies of Gr59c across Drosophila species could reveal evolutionary adaptations in taste perception related to different ecological niches and dietary preferences. Understanding how Gr59c contributes to taste discrimination could also inform broader questions about sensory coding and decision-making based on gustatory inputs. Additionally, studies of Gr59c might reveal principles of receptor-ligand interactions that are applicable to other chemosensory systems.

How might Gr59c research contribute to applied entomology?

Research on Gr59c has potential applications in agricultural pest management and vector control strategies. If Gr59c is involved in detecting specific plant compounds or in feeding behaviors, this knowledge could be leveraged to develop new repellents or attractants that target insect feeding. Understanding the molecular basis of taste perception in Drosophila provides a model for similar systems in agricultural pests or disease vectors like mosquitoes. Compounds that specifically activate or inhibit Gr59c could potentially be developed into novel insecticides or behavior-modifying agents. Additionally, comparative studies of Gr59c across insect species might reveal species-specific differences that could be exploited for the development of targeted pest control strategies with reduced environmental impact.

What are common challenges in expressing recombinant Gr59c?

Expressing recombinant gustatory receptors like Gr59c presents several technical challenges. Membrane proteins often express poorly and may misfold or aggregate in heterologous systems. Based on experiences with other GRs, researchers might encounter low expression levels of Gr59c, as GR gene expression levels are typically exceedingly low . Another challenge is that Gr59c might require co-expression with other GRs to form functional receptors, as seen with GR8a, GR66a, and GR98b in L-canavanine detection . Additionally, the proper trafficking of Gr59c to the cell membrane might require specific chaperones or cellular machinery present in gustatory neurons but absent in heterologous systems. Researchers should consider these factors when designing expression constructs and selecting expression systems.

How can functional assays for Gr59c be optimized?

Optimizing functional assays for Gr59c requires careful consideration of several factors. For in vitro assays, co-expression of multiple GRs may be necessary to reconstitute functional receptor complexes, as demonstrated with GR8a, GR66a, and GR98b . Researchers should test a range of potential ligands at various concentrations, as gustatory receptors can have narrow or broad specificity. For electrophysiological recordings, electrode placement and sensillum selection are critical, as Gr59c might be expressed in only a small subset of sensilla. For calcium imaging, optimizing the expression of calcium indicators and developing proper stimulation protocols are essential. In behavioral assays, controlling for genetic background effects and using appropriate positive and negative controls are important for obtaining reliable results.

What controls should be included in Gr59c functional studies?

Robust controls are essential for Gr59c functional studies. Positive controls should include testing known functional gustatory receptors and their ligands, such as the GR8a/GR66a/GR98b complex with L-canavanine . Negative controls should include flies lacking Gr59c expression, either through mutation or RNAi knockdown, as well as experiments with vehicle solutions lacking potential ligands. For expression studies, controls for antibody specificity and background fluorescence are crucial. In behavioral assays, genetic background controls and wild-type comparisons are necessary. When studying potential Gr59c interactions with other GRs, experiments should include both single-receptor and combined-receptor expressions to determine whether functional responses require multiple receptors. These controls help ensure that experimental results are specifically attributable to Gr59c function rather than to experimental artifacts or indirect effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.