Recombinant Drosophila melanogaster Putative gustatory receptor 59d (Gr59d)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Gr59d (Gene ID: CG30330) is a recombinant protein belonging to the insect gustatory receptor (GR) family. It is produced in heterologous systems such as E. coli, yeast, baculovirus, or mammalian cells, achieving ≥85% purity via SDS-PAGE . The receptor shares gene aliases (GR59D.1, 59D1) and structural features with other GRs, including seven transmembrane domains and a ligand-gated ion channel architecture .

Research Applications

Gr59d is utilized in two primary contexts:

  1. Antibody Development: A rabbit polyclonal antibody (IgG isotype) targets Gr59d for immunohistochemistry and Western blotting, validated in Drosophila tissues .

  2. Ligand Screening: Recombinant Gr59d can be expressed in heterologous systems (e.g., HEK293 cells) to identify activating or inhibitory compounds, paralleling methods used for Gr59c .

Unresolved Questions and Future Directions

  • Ligand Specificity: No direct ligands have been identified for Gr59d, unlike related receptors (e.g., Gr5a for sugars, Gr59c for lobeline) .

  • Cellular Context: GRs often require co-receptors for functionality . Identifying Gr59d’s interaction partners is critical.

  • Behavioral Role: In vivo studies using Gr59d mutants or knockouts could clarify its impact on feeding or avoidance behaviors.

Comparative Analysis with Related Receptors

ReceptorFunctionLigandsKey Studies
Gr59cBitter compound detectionLobeline, denatonium
Gr66aCore bitter receptorCaffeine, L-canavanine
Gr5aSweet taste detectionSucrose, maltose
Gr59dPutative bitter/modulatory roleUnknown

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr59d; GR59D.1; CG30330; Putative gustatory receptor 59d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr59d
Target Protein Sequence
MADLLKLCLRIAYAYGRLTGVINFKIDLKTGQALVTRGATLISVSTHLLIFALLLYQTMR KSVVNVMWKYANSLHEYVFLVIAGFRVVCVFLELVSRWSQRRTFVRLFNSFRRLYQRNPD IIQYCRRSIVSKFFCVTMTETLHIIVTLAMMRNRLSIALALRIWAVLSLTAIINVIITQY YVATACVRGRYALLNKDLQAIVTESQSLVPNGGGVFVTKCCYLADRLERIAKSQSDLQEL VENLSTAYEGEVVCLVITYYLNMLGTSYLLFSISKYGNFGNNLLVIITLCGIVYFVFYVV DCWINAFNVFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMVFENFALNLVRNPLKLHMYGL FEFGRGTSFAVFNSLLTHSLLLIQYDVQNF
Uniprot No.

Target Background

Function
Probable gustatory receptor that mediates acceptance or avoidance behavior depending on its substrates.
Database Links

KEGG: dme:Dmel_CG30330

STRING: 7227.FBpp0071886

UniGene: Dm.26350

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr22e subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adult labellar chemosensory neurons. In larvae, is expressed in neurons of the terminal external chemosensory organ as well as in the dorsal pharyngeal sense organ.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.