Recombinant Drosophila melanogaster Putative gustatory receptor 61a (Gr61a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr61a; CG13888; Gustatory receptor for sugar taste 61a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr61a
Target Protein Sequence
MSRTSDDIRKHLKVRRQKQRAILAMRWRCAQGGLEFEQLDTFYGAIRPYLCVAQFFGIMP LSNIRSRDPQDVKFKVRSIGLAVTGLFLLLGGMKTLVGANILFTEGLNAKNIVGLVFLIV GMVNWLNFVGFARSWSHIMLPWSSVDILMLFPPYKRGKRSLRSKVNVLALSVVVLAVGDH MLYYASGYCSYSMHILQCHTNHSRITFGLYLEKEFSDIMFIMPFNIFSMCYGFWLNGAFT FLWNFMDIFIVMTSIGLAQRFQQFAARVGALEGRHVPEALWYDIRRDHIRLCELASLVEA SMSNIVFVSCANNVYVICNQALAIFTKLRHPINYVYFWYSLIFLLARTSLVFMTASKIHD ASLLPLRSLYLVPSDGWTQEVQRFADQLTSEFVGLSGYRLFCLTRKSLFGMLATLVTYEL MLLQIDAKSHKGLRCA
Uniprot No.

Target Background

Function
Gr61a is one of the few identified sugar gustatory receptors characterized so far. It exhibits a primary preference for glucose as its ligand and plays a crucial role in mediating acceptance behavior in Drosophila melanogaster.
Gene References Into Functions
  1. Research has demonstrated that glucose is the primary ligand for the sugar receptor Gr61a. This receptor is expressed not only in sweet-sensing neurons of classical chemosensory sensilla but also in two supersensitive neurons of atypical taste sensilla. PMID: 23418550
Database Links

KEGG: dme:Dmel_CG13888

STRING: 7227.FBpp0072482

UniGene: Dm.5380

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr5a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in sweet sensing neurons of classical chemosensory sensilla, but also in two supersensitive neurons of atypical taste sensilla.

Q&A

What is Drosophila melanogaster Gr61a and what is its primary function?

Gr61a (Gustatory receptor 61a) is a member of the putative sugar receptor subfamily in Drosophila melanogaster. It functions primarily as a glucose receptor and is broadly co-expressed in sweet cells with other gustatory receptors such as Gr5a and Gr64f, which are required for sensing trehalose and many other sugars, respectively . The Gr61a gene is highly conserved throughout the Drosophila lineage, suggesting its evolutionary importance .

Functionally, Gr61a is necessary for both cellular and behavioral responses to glucose. Ca²⁺ imaging studies clearly demonstrate that Gr61a is an integral component of glucose receptors in specific tarsal chemosensory sensilla . When the gene is deleted, flies show dramatically decreased glucose sensing in 5V2- and 5V1- sensilla compared to control flies .

How does Gr61a relate to other gustatory receptors in Drosophila melanogaster?

Gr61a belongs to a phylogenetically distinct group of gustatory receptors referred to as Gr-S, which includes Gr5a, Gr64a-f, and Gr61a. All eight members of this group are candidate sugar receptors . While Gr5a was reported to be specifically activated by trehalose, Gr61a's function is more specific to glucose detection .

The relationship between Gr61a and other gustatory receptors illustrates the complex taste encoding system in Drosophila:

Gustatory ReceptorPrimary Sugar Ligand(s)Sensilla Expression
Gr61aGlucoseTarsal sensilla (especially 5V2 and 5V1)
Gr5aTrehaloseLabellum and tarsal sensilla
Gr64aSucrose, glucose, maltoseVarious sensilla
Gr64fMultiple sugarsBroadly expressed in sweet cells

Gr61a is co-expressed with Gr5a and Gr64f in sweet cells, suggesting functional interaction between these receptors in sugar sensing . Unlike the mammalian system where T1R2 and T1R3 seem to account for all sugar responses, Drosophila appears to have a larger repertoire of sugar receptors, each with potentially specialized functions .

What phenotypes are observed in Gr61a-deficient Drosophila?

Gr61a-deficient flies (ΔGr61a) display distinct phenotypes in both cellular responses and behavioral assays:

  • Cellular response deficiencies:

    • 5V2- and 5V1-associated sweet neurons of ΔGr61a flies show virtually no response to glucose, while control flies exhibit robust responses .

    • No significant differences in Ca²⁺ responses are observed when stimulated with fructose, sucrose, trehalose, arabinose, or maltose, suggesting specificity for glucose .

  • Behavioral deficits:

    • ΔGr61a homozygous mutant flies exhibit reduced Proboscis Extension Reflex (PER) responses to glucose .

    • When the Gr61a-Gal4 driver and the UAS-Gr61a transgene were crossed into ΔGr61a homozygous flies, a significant PER increase was observed specifically with glucose solutions, confirming Gr61a's role in glucose sensing .

Interestingly, the residual PER response to glucose in ΔGr61a flies, as well as the electrophysiological response to glucose of L-type sensilla in the labellum of such flies, suggests functional redundancy between putative sugar receptors .

How does functional redundancy affect the interpretation of Gr61a knockout studies?

Functional redundancy presents a significant challenge in interpreting Gr61a knockout studies. Previous electrophysiological analyses of labellar taste sensilla in wild type and ΔGr61a mutant flies did not reveal a function for this gene in sugar sensing, despite its clear role demonstrated by Ca²⁺ imaging and behavioral assays .

This apparent contradiction can be explained by functional redundancy between gustatory receptors. The residual PER response to glucose in ΔGr61a flies suggests that additional psGr genes might be functionally redundant and co-expressed with Gr61a in labellar taste sensilla . This would explain the lack of a glucose sensing phenotype in labellar sweet neurons despite the clear phenotype in tarsal neurons.

The complexity of redundancy is further illustrated by the fact that flies lacking all eight putative sugar receptors still respond to fructose and sucrose, which is mediated by yet another Gr protein, Gr43a . This suggests multiple levels of backup systems for critical sensory functions.

What is the relationship between Gr61a expression levels and glucose sensitivity?

Research demonstrates a complex relationship between Gr61a expression levels and glucose sensitivity in Drosophila. When ΔGr61a flies were complemented with a UAS-Gr61a transgene driven by Gr61a-GAL4, complete restoration of the Ca²⁺ response to glucose was observed .

Interestingly, manipulating expression levels produced unexpected effects:

  • 5D1-associated neurons, which normally show negligible response to glucose in both control and ΔGr61a flies, exhibited a significant increase in response when expressing the UAS-Gr61a transgene .

  • An increased response to sucrose (which contains a glucose moiety) was observed in 5V2-associated sweet neurons expressing the UAS-Gr61a transgene, compared to homozygous mutants and controls .

These findings suggest that overexpression of Gr61a increases protein levels of functional glucose/sucrose receptors, thereby enhancing neuronal sensitivity to these sugars . This indicates that receptor stoichiometry plays a crucial role in determining the sensitivity and specificity of gustatory neurons to specific sugars.

How do different gustatory receptors coordinate in multimeric receptor complexes?

In Drosophila melanogaster, structurally diverse chemicals are detected by multimeric receptors composed of members of a large family of Gustatory receptor (Gr) proteins . The coordinated function of these receptors is critical for proper taste discrimination.

Evidence suggests that altered Gr stoichiometry can affect the function of these multimeric complexes. For example, the PER response to trehalose decreased in flies overexpressing Gr61a, possibly because altered Gr stoichiometry caused by Gr61a overexpression increases the amount of one receptor (glucose) at the expense of another (trehalose) in some neurons .

The coordination between receptors may involve:

  • Co-expression patterns: All seven Grs most related to Gr5a (Gr64a-f and Gr61a) were expressed in Gr5a-expressing cells, suggesting functional cooperation .

  • Subunit composition: Different combinations of Gr proteins likely form distinct functional receptors with different ligand specificities.

  • Signal integration: Individual neurons within a taste modality appear to express distinct repertoires of sweet and bitter taste receptors, allowing for complex signal integration .

What techniques are most effective for studying Gr61a function in vivo?

Several complementary techniques have proven effective for studying Gr61a function in vivo:

  • Ca²⁺ imaging: This method allows association of ligand-mediated responses to a single Gustatory Receptor Neuron (GRN) . Ca²⁺ imaging has been particularly valuable in identifying glucose as the primary ligand for Gr61a and in characterizing the response profiles of different sweet neurons to various sugars .

  • Proboscis Extension Reflex (PER) assays: These behavioral assays provide a quantifiable measure of taste responses in flies. PER assays with wild type, ΔGr61a homozygous mutants, and rescue flies have been instrumental in establishing the behavioral significance of Gr61a in glucose sensing .

  • Genetic manipulation:

    • Gene deletion (ΔGr61a)

    • GAL4-UAS system for targeted expression

    • Rescue experiments with UAS-Gr61a transgenes

  • mRNA tagging approach: This technique has been used to identify Gr RNAs that are coexpressed with Gr5a, revealing that Gr61a and other Gr-S family members are enriched in Gr5a-expressing GRNs .

The most comprehensive understanding comes from combining these approaches. For example, the identification of Gr61a as a glucose receptor was confirmed through a combination of Ca²⁺ imaging in mutant flies, behavioral assays, and genetic rescue experiments .

How can researchers address the challenges of low expression levels when studying gustatory receptors?

The extremely low expression levels of gustatory receptors present significant experimental challenges. Research suggests that expression levels of the GR genes are exceedingly low, as evidenced by the fact that no expressed sequence tags have been identified for many GR transcripts .

Effective methodological approaches to address this challenge include:

  • RT-PCR amplification from microdissected tissues: This approach has successfully detected GR transcripts in surgically excised taste organs like the labral sense organ (LSO), which contains a limited number of cells highly enriched in taste neurons .

  • mRNA tagging approach: This technique has proven valuable for identifying Grs that are coexpressed with Gr5a, overcoming the limitations of traditional in situ hybridization methods which have been unsuccessful for many Gr RNAs .

  • GAL4-UAS system for visualization: Using reporter constructs driven by gustatory receptor promoters allows visualization of expression patterns despite low endogenous expression levels.

  • Single-cell RNA sequencing: This emerging technique may provide higher sensitivity for detecting low-abundance transcripts in individual gustatory receptor neurons.

  • Protein tagging methods: Adding epitope tags to gustatory receptors can facilitate detection through immunohistochemistry when antibodies against the native proteins are unavailable or ineffective.

What are the most reliable methods for functional characterization of recombinant Gr61a?

Functional characterization of recombinant Gr61a can be reliably achieved through several complementary approaches:

  • Genetic rescue experiments: Expression of UAS-Gr61a transgenes in ΔGr61a mutant backgrounds has successfully demonstrated functional rescue at both cellular and behavioral levels . This approach confirms the specificity of the phenotype and the functionality of the recombinant protein.

  • Ca²⁺ imaging with GCaMP: Using genetically encoded calcium indicators like GCaMP3.0 driven by Gr61a-GAL4 allows direct visualization of neuronal responses to glucose and other tastants in both wild-type and mutant backgrounds .

  • Heterologous expression systems: Though not described in the provided search results, expression of recombinant Gr61a in cell culture systems or Xenopus oocytes could potentially be used for functional characterization, although these systems have historically been challenging for insect gustatory receptors.

  • Electrophysiological recordings: While electrophysiological analyses of labellar taste sensilla did not reveal functional differences between wild type and ΔGr61a mutant flies , this approach remains valuable when applied to appropriate sensilla (e.g., tarsal sensilla rather than labellar sensilla).

Data comparison between these methods in wild-type, mutant, and rescue genotypes:

MethodWild Type Response to GlucoseΔGr61a Mutant ResponseRescue Response
Ca²⁺ imaging (5V2/5V1 sensilla)Robust responseVirtually no responseComplete restoration
PER assayHigher responseReduced responseSignificant increase
Electrophysiology (labellar)Normal responseNormal responseNot applicable

This multi-method approach provides strong evidence for Gr61a's specific role as a glucose receptor in Drosophila .

How should researchers interpret contradictory results between electrophysiological and Ca²⁺ imaging studies of Gr61a?

The contradiction between electrophysiological and Ca²⁺ imaging studies of Gr61a presents an important analytical challenge. While electrophysiological analyses did not reveal functional differences between wild type and ΔGr61a mutant flies in labellar taste sensilla , Ca²⁺ imaging clearly demonstrated that tarsal sweet neurons in 5V2- and 5V1-sensilla of ΔGr61a flies showed virtually no response to glucose .

This apparent contradiction should be interpreted considering:

  • Tissue-specific expression and function: Gr61a may have different functional importance in different sensory organs. The phenotype was observed in tarsal sensilla but not in labellar sensilla, suggesting tissue-specific roles .

  • Functional redundancy: An additional psGr gene might be functionally redundant and co-expressed with Gr61a in labellar taste sensilla but not in tarsal sensilla, explaining the lack of a glucose sensing phenotype in labellar sweet neurons .

  • Methodological sensitivity: Ca²⁺ imaging may detect more subtle changes in neuronal activity than electrophysiological methods, particularly when examining responses in specific subsets of neurons.

  • Receptor stoichiometry: Different sensilla may have different relative expression levels of gustatory receptors, leading to different functional outcomes when a single receptor is removed.

Researchers should interpret these contradictory results as revealing the complex, context-dependent nature of gustatory receptor function rather than viewing them as invalidating either methodology.

What statistical approaches are most appropriate for analyzing Gr61a functional data?

When analyzing functional data for Gr61a, appropriate statistical approaches should address the specific characteristics of the experimental methods used:

  • For Ca²⁺ imaging data:

    • Paired comparisons between wild-type, mutant, and rescue genotypes using paired t-tests or ANOVA with post-hoc tests

    • Time-series analysis to characterize the dynamics of calcium responses

    • Dose-response curve analysis to determine sensitivity thresholds

  • For behavioral assays (PER):

    • Non-parametric tests (Mann-Whitney U or Kruskal-Wallis) are often appropriate as PER data may not be normally distributed

    • Binary response analysis (responded/did not respond) using chi-square tests or Fisher's exact test

    • Logistic regression to analyze probability of response as a function of sugar concentration

  • For expression analysis:

    • Correlation analysis between expression levels and functional responses

    • Principal component analysis to identify patterns in expression across multiple Gr genes

In all cases, researchers should:

  • Use appropriate controls (wild-type, ΔGr61a, and rescue flies)

  • Apply multiple testing corrections when performing numerous comparisons

  • Report effect sizes along with p-values to indicate biological significance

  • Consider biological replicates (different flies) separately from technical replicates

How can researchers distinguish between direct and indirect effects of Gr61a manipulation?

Distinguishing between direct and indirect effects of Gr61a manipulation requires careful experimental design and analysis:

For example, the finding that 5D1-associated neurons showed enhanced glucose responses when expressing the UAS-Gr61a transgene, despite normally showing negligible responses in both control and ΔGr61a flies, suggests that overexpression of Gr61a can have direct effects on glucose sensitivity beyond simply rescuing the native function .

What are the most promising approaches for identifying the complete molecular composition of glucose receptor complexes in Drosophila?

Identifying the complete molecular composition of glucose receptor complexes in Drosophila will require integrative approaches:

  • Proximity labeling techniques: Methods such as BioID or APEX could be used to identify proteins in close proximity to Gr61a in vivo, potentially revealing other components of the glucose receptor complex.

  • Co-immunoprecipitation followed by mass spectrometry: This approach could identify proteins that physically interact with Gr61a, though it requires effective antibodies or epitope-tagged versions of the receptor.

  • Systematic genetic interaction screens: Creating double mutants between ΔGr61a and mutations in other candidate receptor genes could reveal functional interactions and redundancies.

  • CRISPR-based genetic screens: Using CRISPR-Cas9 to generate and screen large numbers of mutant combinations could help identify additional components of glucose receptor complexes.

  • Heterologous expression studies: Reconstituting functional glucose receptors in heterologous systems by expressing different combinations of Gr proteins could determine the minimal components required for glucose sensing.

Given the evidence for functional redundancy in glucose sensing and the finding that flies lacking all eight putative sugar receptors still respond to some sugars , these approaches are likely to reveal additional components beyond the currently known Gr proteins.

How might comparative studies across Drosophila species enhance our understanding of Gr61a evolution and function?

Comparative studies across Drosophila species would provide valuable insights into Gr61a evolution and function:

  • Sequence conservation analysis: The Gr61a gene is already known to be conserved throughout the Drosophila lineage , but detailed analysis of sequence conservation patterns could reveal functionally critical domains and residues.

  • Expression pattern comparison: Examining whether Gr61a expression patterns are conserved across species could indicate functional constraints and evolutionary adaptations.

  • Functional conservation testing: Determining whether Gr61a orthologs from different Drosophila species can rescue glucose sensing in D. melanogaster ΔGr61a mutants would reveal functional conservation.

  • Ecological correlation studies: Correlating Gr61a sequence or expression variations with ecological niches and dietary preferences of different Drosophila species could reveal adaptations to different food sources.

  • Molecular evolution analysis: Calculating selection pressures (dN/dS ratios) across the Gr61a coding sequence would identify regions under purifying or positive selection.

These comparative approaches could help determine whether Gr61a's specificity for glucose is evolutionarily conserved or has undergone functional shifts in different lineages, providing insights into the evolution of taste perception systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.