Recombinant Drosophila melanogaster Putative gustatory receptor 64a (Gr64a)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Sugar Detection

Gr64a is essential for Drosophila’s behavioral and electrophysiological responses to multiple sugars:

  • Behavioral Assays:

    • Gr64a mutants exhibit abolished proboscis extension reflex (PER) to sucrose, glucose, and maltose .

    • Rescue experiments confirm Gr64a’s sufficiency for sucrose/maltose detection when expressed in Gr5a neurons .

  • Electrophysiological Data:

    • Tip recordings show Gr64a-deficient flies lack action potentials in labellar sensilla upon sucrose/maltose stimulation .

Table 2: Sugar Response Deficits in Gr64a Mutants

SugarWild-Type Spike Frequency (Hz)Gr64a Mutant Spike Frequency (Hz)Rescue Efficiency (%)
Sucrose44.0 ± 6.71.4 ± 0.5~90%
Maltose31.8 ± 5.50.8 ± 0.3~43%
Glucose34.4 ± 8.70.2 ± 0.2~37%
Data sourced from Jiao et al. (2007)

Coexpression and Redundancy with Other Receptors

Gr64a operates in concert with other GRs:

  • Gr5a Synergy: Required for trehalose detection, suggesting receptor multimerization .

  • Gr64f Interaction: Acts as a coreceptor for glucose and maltose responses .

  • Polycistronic Expression: The Gr64a-f cluster is transcribed as a single mRNA, enabling coordinated expression in sugar-sensing neurons .

Non-Canonical Roles in Proteostasis

Beyond taste, Gr64a supports cellular survival under proteotoxic stress:

  • Epithelial Cell Survival:

    • Gr64 cluster upregulation in Rp/+ mutants mitigates proteasome/autophagy dysfunction .

    • Loss of Gr64 exacerbates poly-ubiquitinated aggregates and stress signaling .

  • Mechanism:
    Gr64a enhances proteolytic clearance pathways, independent of its neuronal role .

Key Research Findings

  • Structural Activation: Sugar binding to LBDs triggers a "twist-to-open" motion in the PD, enabling Na+/Ca²⁺ influx .

  • Evolutionary Conservation: Gr64a homologs exist in all 12 sequenced Drosophila species, underscoring functional importance .

  • Genetic Rescue: Transgenic Gr64a expression restores sucrose/maltose responses but not trehalose detection, hinting at complex receptor interplay .

Implications and Future Directions

Gr64a’s dual roles in chemosensation and proteostasis highlight its evolutionary versatility. Open questions include:

  • The molecular basis of Gr64a-Gr5a heteromerization.

  • Mechanisms linking proteostasis regulation to receptor structure.

  • Applications in synthetic biology for engineered sugar sensors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, kindly consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point for your preparation.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form offers a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Should you have a specific tag preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Gr64a; CG32261; Gustatory receptor for sugar taste 64a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr64a
Target Protein Sequence
MKGPNLNFRKTPSKDNGVKQVESLARPETPPPKFVEDSNLEFNVLASEKLPNYTNLDLFH RAVFPFMFLAQCVAIMPLVGIRESNPRRVRFAYKSIPMFVTLIFMIATSILFLSMFTHLL KIGITAKNFVGLVFFGCVLSAYVVFIRLAKKWPAVVRIWTRTEIPFTKPPYEIPKRNLSR RVQLAALAIIGLSLGEHALYQVSAILSYTRRIQMCANITTVPSFNNYMQTNYDYVFQLLP YSPIIAVLILLINGACTFVWNYMDLFIMMISKGLSYRFEQITTRIRKLEHEEVCESVFIQ IREHYVKMCELLEFVDSAMSSLILLSCVNNLYFVCYQLLNVFNKLRWPINYIYFWYSLLY LIGRTAFVFLTAADINEESKRGLGVLRRVSSRSWCVEVERLIFQMTTQTVALSGKKFYFL TRRLLFGMAGTIVTYELVLLQFDEPNRRKGLQPLCA
Uniprot No.

Target Background

Function
Gr64a is one of the few identified sugar gustatory receptors. It plays a crucial role in promoting the starvation-induced increase in feeding motivation. Gr64a functions in conjunction with Gr64f to detect sucrose, maltose, and glucose.
Gene References Into Functions
  1. This study demonstrated the functional changes in the taste sensory system and the expression of a sugar taste receptor, Gr64a, during starvation. PMID: 22794108
  2. Both Gr5a and Gr64a can operate independently within individual sugar neurons and are the primary receptors responsible for detecting sugars in the labellum of Drosophila. (Gr64a protein, Drosophila) PMID: 17988633
Database Links

KEGG: dme:Dmel_CG32261

STRING: 7227.FBpp0073050

UniGene: Dm.26367

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr5a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in Gr5a-expressing sugar-sensing cells.

Q&A

What is the molecular structure of Drosophila Gr64a?

Recent cryo-electron microscopy studies have revealed that Drosophila Gr64a forms a tetrameric sugar-gated cation channel. Each tetramer consists of one central pore domain (PD) and four peripheral ligand-binding domains (LBDs). Unlike many mammalian taste receptors that function as G protein-coupled receptors (GPCRs), Gr64a functions as an ion channel with a sugar-binding site located near the extracellular face in a deep, hydrophilic pocket. The structure features a larger and flatter binding pocket compared to related gustatory receptors like GR43a, which correlates with its specificity for disaccharides such as sucrose and maltose .

How does Gr64a differ from other gustatory receptors in Drosophila?

Gr64a belongs to the Gr64 cluster (Gr64a-f), which shares evolutionary relatedness with Gr5a. While both Gr5a and Gr64a are involved in sugar detection, they respond to complementary subsets of sugars. Genetic analysis has demonstrated that Gr5a and Gr64a can function independently within individual sugar neurons, with Gr64a specifically responding to disaccharides. Unlike Gr43a, which specifically binds monosaccharides like fructose in a narrow pocket, Gr64a features a larger binding pocket optimized for larger sugar molecules . Additionally, recent research has revealed that Gr64a and other members of the Gr64 cluster have unexpected non-neuronal functions in proteostasis maintenance in epithelial cells under stress conditions .

What is the genomic organization of the Gr64 cluster?

The Gr64 cluster in Drosophila melanogaster consists of six closely related gustatory receptor genes (Gr64a, Gr64b, Gr64c, Gr64d, Gr64e, and Gr64f) that are arranged in tandem on the genome. These genes likely arose through gene duplication events, as they share higher amino acid sequence similarity with each other than with other gustatory receptors. They are part of the larger gustatory receptor family, which includes 68 members in Drosophila melanogaster. The Gr64 genes are most closely related to Gr5a and Gr61a, forming a subfamily of sweet taste receptors .

Where is Gr64a expressed in Drosophila melanogaster?

Traditionally, Gr64a was understood to be expressed primarily in gustatory receptor neurons (GRNs) in taste sensilla located on the labellum, tarsi, and wing margins of adult flies. These GRNs are stimulated by sweet compounds. Recent evidence indicates that Gr64a is co-expressed with other members of the Gr64 cluster and Gr5a in at least some GRNs. Interestingly, recent research has uncovered expression of Gr64a and other Gr64 cluster genes in non-neuronal tissues, particularly in epithelial cells of imaginal discs in larvae under proteotoxic stress conditions. This unexpected pattern of expression correlates with newly discovered roles of these receptors beyond taste sensation .

What techniques are most effective for visualizing Gr64a expression patterns?

Several complementary approaches have proven effective for visualizing Gr64a expression:

  • GAL4-UAS Reporter System: Using Gr64a-GAL4 driver lines with UAS-GFP or other fluorescent reporters allows visualization of cells expressing Gr64a. This approach has been instrumental in mapping the gustatory circuit.

  • In situ Hybridization: RNA in situ hybridization can directly detect Gr64a mRNA in tissues, though sensitivity can be a challenge due to potentially low expression levels.

  • Immunohistochemistry: When antibodies are available, direct detection of the Gr64a protein is possible, though this has been challenging due to protein structure and expression levels.

  • Genetic Reporters: Flies carrying genomic constructs where Gr64a regulatory regions drive expression of fluorescent proteins have been used to study expression patterns.

These methods have revealed that Gr64a is expressed in sweet-sensing gustatory neurons and, under certain conditions, in non-neuronal tissues .

How does sugar binding activate the Gr64a receptor?

The activation mechanism of Gr64a involves a structural transition from the apo (unbound) to the sugar-bound state. When disaccharides like sucrose or maltose bind to the ligand-binding domains (LBDs) of Gr64a, they induce local conformational changes in these domains. These conformational changes are subsequently transferred to the central pore domain (PD), causing channel opening. Electrophysiological and calcium imaging studies have confirmed that this opening creates a non-selective cation channel that allows ion flux, ultimately leading to neuronal depolarization and signal transduction. The specificity of Gr64a for disaccharides is determined by the size and shape of its binding pocket, which accommodates larger sugar molecules more effectively than monosaccharides .

What is the relationship between Gr64a and Gr5a in sugar detection?

Genetic analysis has demonstrated that Gr5a and Gr64a function as complementary receptors for detecting different subsets of sugars. Gr5a is primarily responsible for the detection of trehalose and other sugars, while Gr64a responds to sucrose, maltose, and other disaccharides. Remarkably, a Gr5a;Gr64a double mutant shows no physiological or behavioral responses to any tested sugar, suggesting that these two receptors account for most or all sugar detection in the labellum. The simplest interpretation is that Gr5a and Gr64a can each function independently within individual sugar neurons, although they may form multimeric complexes with other gustatory receptors .

What ionic conductance properties does Gr64a exhibit?

Electrophysiological studies have shown that Gr64a forms sugar-gated non-selective cation channels. Upon binding of disaccharides like sucrose or maltose, the channel opens to permit cation influx. Structurally, the open state of the channel features a wide pore consistent with non-selective cation conduction. This ion channel function distinguishes Drosophila gustatory receptors from mammalian taste receptors, which primarily function through G protein-coupled receptor (GPCR) signaling. The ion selectivity and conductance properties of Gr64a contribute to its ability to directly depolarize gustatory neurons in response to appropriate sugar stimuli .

What expression systems are most effective for recombinant production of functional Gr64a?

For recombinant production of functional Gr64a, several expression systems have been utilized with varying degrees of success:

  • Insect Cell Lines: Systems such as Sf9 or High Five cells derived from Spodoptera frugiperda are often preferred for expressing Drosophila proteins as they provide insect-specific post-translational modifications and membrane composition.

  • Drosophila S2 Cells: These cells derived from Drosophila embryos offer an optimal cellular environment for proper folding and processing of Drosophila proteins.

  • Mammalian Expression Systems: HEK293 cells have been used successfully, particularly when codon optimization and appropriate trafficking signals are incorporated into the expression construct.

  • Xenopus Oocytes: This system has been valuable for electrophysiological characterization of ion channel properties of gustatory receptors.

Key considerations for successful expression include: codon optimization, inclusion of appropriate signal sequences, addition of affinity tags that don't interfere with function, and temperature control during expression to facilitate proper folding .

What methods are most reliable for assessing Gr64a function in vivo?

Several complementary approaches have proven effective for assessing Gr64a function in living flies:

  • Two-Choice Feeding Preference Assays: These behavioral assays measure Drosophila feeding preferences between solutions with different sugar compositions. Comparison between wild-type flies and Gr64a mutants can reveal the role of Gr64a in sugar preference.

  • Proboscis Extension Reflex (PER): This assay measures the reflexive extension of the proboscis when the tarsi or labellum contact sugar solutions, providing a direct readout of gustatory neuron activation.

  • Electrophysiological Recordings: Tip recordings from taste sensilla can directly measure neuronal responses to sugar stimulation in wild-type versus Gr64a mutant flies.

  • Calcium Imaging: Expression of calcium indicators like GCaMP in Gr64a-expressing neurons allows visualization of neuronal activation patterns in response to different sugars.

  • CAFÉ Assay (Capillary Feeder): This quantitative feeding assay can measure consumption of different sugar solutions over time.

These approaches, particularly when used in combination, provide robust assessments of Gr64a function in sugar detection and feeding behavior .

How does Gr64a contribute to proteostasis in non-neuronal tissues?

Recent research has uncovered an unexpected role for the Gr64 cluster, including Gr64a, in maintaining proteostasis in epithelial cells under proteotoxic stress. In Drosophila imaginal discs with heterozygous mutations in ribosomal proteins (Rp/+), which induce proteotoxic stress and protein aggregation, the entire Gr64 cluster is upregulated. These Rp/+ cells depend on Gr64 receptors for survival, as loss of Gr64 exacerbates stress pathway activation and proteotoxic stress. Mechanistically, Gr64 appears to support proteostasis by positively affecting autophagy and proteasome function. When Gr64 is depleted in Rp/+ cells, there is marked increase in apoptosis, demonstrating the critical importance of this non-canonical function. This work identifies a previously unknown role for gustatory receptors beyond their traditional sensory functions .

What molecular pathways link Gr64a to proteostasis maintenance?

The molecular mechanisms connecting Gr64a to proteostasis maintenance involve several key pathways:

  • Autophagy Regulation: Loss of Gr64 in Rp/+ cells negatively affects autophagy, a critical process for removing protein aggregates and damaged organelles. This suggests that Gr64a may normally promote autophagy flux under stress conditions.

  • Proteasome Function: Gr64 receptors appear to support proteasome function, which is essential for degrading misfolded or damaged proteins. Without Gr64, proteasome activity is compromised in cells experiencing proteotoxic stress.

  • Stress Pathway Modulation: In the absence of Gr64, stress pathway activation is exacerbated in Rp/+ cells, suggesting that Gr64 may help dampen cellular stress responses.

These findings indicate that Gr64a and other members of the Gr64 cluster play important roles in cellular homeostasis beyond their canonical functions in taste sensation, potentially through mechanisms involving calcium signaling or other second messenger systems .

How do multimerization and receptor interactions influence Gr64a function?

The functional Drosophila gustatory receptors appear to include three or more subunits, contrasting with mammalian taste receptors which typically form dimers. Recent structural studies have confirmed that Gr64a forms tetramers consisting of one central pore domain surrounded by four peripheral ligand-binding domains. This tetrameric structure is crucial for channel function. While Gr64a can function independently of Gr5a, it may interact with other members of the Gr64 cluster or additional gustatory receptors to form heteromeric complexes with distinct functional properties. The precise subunit composition of these complexes in different cell types remains an area of active investigation. These subunit interactions likely influence ligand specificity, channel properties, and downstream signaling pathways .

What are the evolutionary implications of Gr64a's dual roles in gustation and proteostasis?

The discovery that Gr64a and related receptors function both in taste sensation and proteostasis raises intriguing evolutionary questions. This dual functionality suggests several possibilities:

  • Ancient Origin: The proteostasis function might represent an ancestral role of these proteins, with taste sensation evolving later as a specialized function in sensory neurons.

  • Functional Repurposing: Alternatively, these receptors may have originally evolved for taste sensation and were later repurposed for proteostasis functions in other tissues.

  • Shared Signaling Mechanisms: Both functions might rely on similar molecular mechanisms, such as calcium signaling, suggesting an evolutionary link between sensory perception and cellular stress responses.

  • Taxonomic Distribution: Examining whether this dual functionality exists in other insect species could provide insights into when these functions diverged or converged during evolution.

This unexpected pleiotropy highlights how seemingly specialized sensory receptors can serve broader physiological roles and suggests potential new research directions in understanding cellular stress responses across species .

What methodological approaches can resolve contradictory findings about Gr64a function?

Researchers investigating Gr64a function have sometimes reported contradictory findings, particularly regarding sugar specificity and expression patterns. Several methodological approaches can help resolve these contradictions:

  • Cell-Specific Knockdown/Rescue: Using tissue-specific drivers to knock down or express Gr64a in defined cell populations can distinguish cell-autonomous versus non-autonomous effects.

  • CRISPR-Mediated Precise Mutations: Creating targeted mutations in specific domains of Gr64a can help distinguish structure-function relationships more precisely than whole-gene deletions.

  • Single-Cell Transcriptomics: This approach can resolve heterogeneity in Gr64a expression across different cell types and physiological conditions.

  • Heterologous Expression Systems: Testing Gr64a function in well-controlled expression systems can isolate its intrinsic properties from contextual influences.

  • Combinatorial Receptor Studies: Expressing different combinations of gustatory receptors can reveal interaction effects that might explain functional variability.

These approaches, particularly when applied in combination, can help reconcile divergent findings and build a more coherent understanding of Gr64a biology .

What purification strategies yield highest functional recovery of recombinant Gr64a?

Purification of functional recombinant Gr64a presents challenges due to its membrane protein nature. Based on successful approaches with similar proteins, the following strategies are recommended:

  • Detergent Screening: Systematic testing of mild detergents such as DDM, LMNG, or GDN is critical for solubilization while maintaining protein integrity. A detergent screen should be performed to identify optimal conditions.

  • Affinity Chromatography: N- or C-terminal tags (His8, FLAG, or streptavidin-binding peptide) can facilitate initial capture, though tag placement should avoid interference with function.

  • Size Exclusion Chromatography: Critical for isolating properly assembled tetrameric complexes from aggregates or partially assembled intermediates.

  • Lipid Nanodisc Reconstitution: Transferring purified protein into lipid nanodiscs can enhance stability and functional properties by providing a native-like membrane environment.

  • On-Column Detergent Exchange: Gradually transitioning between detergents during purification can improve protein stability and homogeneity.

Purification should be performed at 4°C with protease inhibitors, and functional integrity should be verified through binding assays or electrophysiological measurements post-purification .

What are the critical quality control parameters for assessing recombinant Gr64a integrity?

Multiple complementary approaches should be used to assess the quality of recombinant Gr64a preparations:

  • Biochemical Homogeneity:

    • SDS-PAGE to confirm protein purity and molecular weight

    • Native PAGE or BN-PAGE to assess oligomeric state

    • Size exclusion chromatography profiles to evaluate monodispersity

  • Structural Integrity:

    • Circular dichroism spectroscopy to verify secondary structure composition

    • Thermal stability assays (e.g., DSF) to assess folding stability

    • Limited proteolysis to probe for properly folded domains

  • Functional Activity:

    • Sugar binding assays (e.g., microscale thermophoresis or isothermal titration calorimetry)

    • Electrophysiological measurements in reconstituted systems

    • Calcium flux assays in appropriate cellular contexts

  • Biophysical Characterization:

    • Dynamic light scattering to assess sample homogeneity

    • Negative-stain electron microscopy to verify particle morphology

These quality control measures are critical for ensuring that the recombinant protein accurately represents the native Gr64a in structural and functional studies .

How might targeting Gr64a lead to novel strategies for controlling insect behavior?

Understanding Gr64a function could inform novel approaches to insect behavior control:

  • Designer Attractants: Knowledge of Gr64a's sugar binding properties could enable development of highly specific attractants for pest management strategies, potentially creating more effective baits that selectively target specific insect species.

  • Feeding Deterrents: Conversely, compounds that block Gr64a function could serve as feeding deterrents for agricultural pest species, providing an alternative to traditional insecticides.

  • Species-Specific Control: Comparative studies of Gr64a across disease vectors (e.g., Anopheles, Aedes) could reveal species-specific features that might be exploited for targeted control of disease-carrying insects while sparing beneficial species.

  • Genetic Control Strategies: Genetic manipulation of Gr64a expression could potentially alter feeding preferences in genetically modified insects used in population control strategies.

These approaches require detailed understanding of structure-function relationships and species-specific differences in Gr64a properties, highlighting the practical applications of basic research in this area .

What are the implications of Gr64a's non-canonical functions for understanding cellular stress responses?

The discovery that Gr64a and other gustatory receptors play roles in proteostasis opens new research directions:

  • Therapeutic Targets: Understanding how Gr64a supports proteostasis could reveal conserved mechanisms relevant to human diseases involving protein aggregation, such as neurodegenerative disorders.

  • Stress Response Integration: Gr64a may represent a previously unrecognized link between environmental sensing and cellular stress responses, suggesting new paradigms for how organisms detect and respond to stressors.

  • Cellular Adaptation Mechanisms: The dual functionality of Gr64a suggests potential mechanisms by which cells might repurpose existing molecular machinery for new functions during adaptation to stress.

  • Biomarkers of Cellular Stress: Expression of Gr64a in non-neuronal tissues could potentially serve as a biomarker for certain types of proteotoxic stress in research contexts.

These implications highlight how discoveries about seemingly specialized sensory receptors can have broader impacts on understanding fundamental cellular processes relevant to health and disease .

What experimental approaches might reveal additional non-canonical functions of gustatory receptors?

To uncover additional non-canonical functions of gustatory receptors like Gr64a, researchers might consider:

  • Tissue-Specific Transcriptomics: Single-cell RNA sequencing across diverse tissues and developmental stages could reveal unexpected expression patterns of gustatory receptors outside sensory neurons.

  • Conditional Knockout Studies: Tissue-specific and temporally controlled deletion of Gr64a could help identify phenotypes in non-neuronal tissues under various stress conditions.

  • Interactome Mapping: Proteomics approaches to identify binding partners of Gr64a in different cellular contexts might reveal connections to previously unrecognized signaling pathways.

  • Cross-Species Comparative Studies: Examining non-canonical functions of gustatory receptor homologs across distantly related species could help identify evolutionarily conserved roles.

  • Drug-Target Screens: Using chemical genetics approaches to identify compounds that modulate Gr64a activity in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.