Recombinant Drosophila melanogaster Putative gustatory receptor 77a (Gr77a)

Shipped with Ice Packs
In Stock

Description

Biological Function and Research Findings

Gr77a is a gustatory receptor (GR) critical for detecting aversive compounds in Drosophila melanogaster. Key findings include:

Role in L-Canavanine Detection

  • Gr77a functions alongside Gr8a and Gr98b to mediate avoidance of L-canavanine, a toxic plant alkaloid .

  • Co-expression of these receptors in bitter-sensing gustatory receptor neurons (GRNs) confers sensitivity to L-canavanine .

  • Misexpression in sweet-sensing GRNs converts L-canavanine from an aversive to an attractive stimulus .

Expression Pattern

  • Localized to GRNs in I1, S1, S3, S5, S6, S7, S10, and S11 sensilla on legs, wings, and proboscis .

  • Overlaps with Gr66a-expressing neurons, which are broadly tuned to bitter compounds .

Genetic Knockout Phenotypes

  • Gr98b mutants (homolog of Gr77a) lose L-canavanine avoidance, rescued by reintroducing Gr77a under Gr66a-GAL4 .

  • RNAi knockdown of Gr77a disrupts chemosensory responses to noxious stimuli .

Subunit Composition

  • Gr77a operates as part of a multi-subunit receptor complex, typical of Drosophila GRs .

  • Unlike mammalian GPCR taste receptors, GRs like Gr77a form ligand-gated cation channels .

Evolutionary Conservation

  • Gustatory receptors in insects exhibit species-specific adaptations. Gr77a homologs in other drosophilids (e.g., D. simulans, D. virilis) share roles in toxin avoidance .

Use in Behavioral Studies

  • Recombinant Gr77a enables in vitro ligand-binding assays to map receptor specificity .

  • Critical for studying chemosensory coding and neural circuits underlying taste aversion .

Comparative Analysis with Other Gustatory Receptors

ReceptorFunctionLigand Specificity
Gr77aAversive compound detectionL-canavanine, bitter alkaloids
Gr32aCourtship inhibition7-tricosene (pheromone)
Gr66aBroadly tuned bitter sensorCaffeine, strychnine
Gr5aSweet perceptionSugars

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Gr77a; GR77E.1; CG32433; Putative gustatory receptor 77a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr77a
Target Protein Sequence
MPLPLGDPLALAVSPQLGYIRITAMPRWLQLPGMSALGILYSLTRVFGLMATANWSPRGI KRVRQSLYLRIHGCVMLIFVGCFSPFAFWCIFQRMAFLRQNRILLMIGFNRYVLLLVCAF MTLWIHCFKQAEIIGCLNRLLKCRRRLRRLMHTRKLKDSMDCLATKGHLLEVVVLLSSYL LSMAQPIQILKDDPEVRRNFMYACSLVFVSVCQAILQLSLGMYTMAILFLGHLVRHSNLL LAKILADAEHIFESSQKAGFWPNRQELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLC AVQAVCFLGFVPLECTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVI LPTYYSERRFNCTREIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSACGLFK LNNAILFCIVGAILEYLMILIQFDKVLNK
Uniprot No.

Target Background

Function

Function: Putative gustatory receptor potentially mediating acceptance or avoidance behavior in Drosophila melanogaster, depending on the presented substrates.

Database Links

KEGG: dme:Dmel_CG32433

STRING: 7227.FBpp0077939

UniGene: Dm.27968

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr77a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In larvae, is expressed in dorsal pharyngeal sense organ.

Q&A

What is Gr77a and what is its significance in Drosophila melanogaster?

Gr77a is a putative gustatory receptor in Drosophila melanogaster that belongs to the larger family of gustatory receptors (GRs). While specific information on Gr77a is limited in the provided search results, research on related gustatory receptors indicates these proteins function in contact chemosensation, which includes taste perception and detection of non-volatile compounds . Gustatory receptors in Drosophila are particularly significant because they represent a distinct chemosensory receptor family that functions in both contact and non-contact chemosensation, making them valuable models for understanding chemosensory systems across species .

How are gustatory receptors like Gr77a typically expressed in Drosophila?

Gustatory receptors in Drosophila are expressed in gustatory receptor neurons (GRNs). Based on studies of other GRs, expression patterns can be determined through techniques such as DNA microarrays comparing wild-type flies with mutants lacking chemosensory sensilla (e.g., poxn mutants) . The major taste organ in Drosophila is the labellum, and GRs can be detected in different cellular compartments including dendrites, axons, and cell bodies of GRNs . When studying Gr77a specifically, researchers would likely examine its expression pattern in relation to other well-characterized GRs such as Gr33a, Gr66a, or members of the Gr64 family, which are known to be enriched in wild-type labella .

What are the common approaches for creating recombinant Drosophila strains expressing modified Gr77a?

The creation of recombinant Drosophila strains expressing modified Gr77a typically involves recombinant DNA techniques. These techniques include:

  • PCR amplification or de novo synthesis of the Gr77a gene with desired modifications

  • Cloning into appropriate plasmid vectors

  • Transformation into Drosophila using established techniques such as P-element-mediated transformation

As noted in the NIH guidelines for recombinant DNA research, such work requires proper registration and approval from institutional biosafety committees . The recombinant constructs may include reporter genes (such as GFP) to visualize expression patterns or modified versions of Gr77a to study structure-function relationships.

What regulatory considerations apply when working with recombinant Gr77a in Drosophila?

Research involving recombinant Drosophila strains expressing modified Gr77a must comply with institutional and national guidelines for recombinant DNA research. According to NIH guidelines, all research using recombinant DNA materials must be registered regardless of funding source . Investigators are responsible for understanding and following these guidelines, which may include:

  • Registration with the Institutional Biosafety Committee (IBC)

  • Submission of detailed protocols describing the recombinant constructs

  • Risk assessment of the research

  • Implementation of appropriate biosafety measures

Drosophila research typically falls into lower risk categories, but proper documentation and approval are still required .

How can quantitative trait locus (QTL) mapping be applied to study natural variation in Gr77a function?

QTL mapping represents a powerful approach to identify natural alleles that contribute to variable phenotypes related to gustatory reception, including potential variations in Gr77a function. Based on methodologies used for other Drosophila genes, the process would involve:

  • Utilizing large, stable sets of highly-recombinant genotypes derived from multiparental mapping populations such as the Drosophila Synthetic Population Resource (DSPR)

  • Phenotyping the recombinant inbred lines (RILs) for traits related to Gr77a function, such as behavioral responses to specific tastants

  • Genotyping the RILs using approaches like Restriction site Associated DNA (RAD) tags

  • Applying hidden Markov models (HMM) to determine the underlying mosaic haplotype structure of each RIL

  • Statistical analysis to identify genomic regions associated with variation in the measured phenotype

This approach has successfully identified candidate genes contributing to nicotine resistance and responses to other compounds in Drosophila . For Gr77a specifically, researchers might look for QTLs associated with behavioral or physiological responses to tastants potentially detected by this receptor.

What experimental designs are optimal for characterizing the functional role of Gr77a in taste perception?

To characterize the functional role of Gr77a in taste perception, several complementary experimental approaches can be employed:

Behavioral Assays:

  • Trap assays - Using traps containing different tastants with or without potential Gr77a ligands, similar to methodologies used for DEET repellency studies

  • Feeding preference assays - Comparing consumption of solutions with different tastants

  • Egg-laying preference assays - Evaluating oviposition preferences in the presence of different substrates

Electrophysiological Methods:

  • Single sensillum recordings (SSR) - Measuring neuronal responses to stimuli by recording from individual sensilla, as described for DEET response studies

Genetic Manipulation:

  • RNAi knockdown - Specifically targeting Gr77a in taste neurons to assess behavioral and physiological consequences

  • CRISPR/Cas9 gene editing - Creating precise mutations in Gr77a

  • Rescue experiments - Reintroducing wild-type or modified Gr77a into mutant backgrounds

Expression Studies:

  • Reporter gene assays - Using fluorescent proteins to visualize expression patterns

  • Quantitative RT-PCR - Measuring expression levels under different conditions

These approaches together would provide a comprehensive understanding of when, where, and how Gr77a functions in Drosophila taste perception.

How can potential functional redundancy between Gr77a and other gustatory receptors be systematically investigated?

Investigating functional redundancy between Gr77a and other gustatory receptors requires a systematic approach combining genetic, behavioral, and molecular techniques:

  • Co-expression analysis:

    • Determine which GRNs co-express Gr77a and other gustatory receptors

    • Use dual-reporter strains or immunohistochemistry to visualize co-expression patterns

  • Genetic interaction studies:

    • Generate single and double/multiple mutants of Gr77a and related receptors

    • Compare phenotypes to identify synergistic or epistatic interactions

    • Create RNAi combinations targeting multiple receptors simultaneously

  • Heterologous expression systems:

    • Express Gr77a alone or in combination with other GRs in cell culture systems

    • Measure responses to potential ligands using calcium imaging or other functional assays

  • Cross-species comparative analysis:

    • Compare the function of Gr77a orthologs in related Drosophila species

    • Identify conserved and divergent features that might indicate functional redundancy

  • Structure-function analysis:

    • Create chimeric receptors combining domains from Gr77a and related GRs

    • Test functionality to identify domains responsible for specific ligand interactions

The identification of functional redundancy would be particularly important for understanding why single receptor mutations sometimes show subtle or no phenotypes, as observed with some gustatory receptors involved in DEET detection .

What approaches can be used to identify the specific ligands that activate Gr77a?

Identifying specific ligands for Gr77a requires multiple complementary approaches:

  • High-throughput screening:

    • Test libraries of tastants using behavioral assays with wild-type and Gr77a mutant flies

    • Screen for compounds that elicit differential responses between genotypes

  • Electrophysiological screening:

    • Perform single sensillum recordings (SSR) from Gr77a-expressing sensilla

    • Measure responses to candidate tastants

    • Compare responses in wild-type and Gr77a mutant backgrounds

  • Heterologous expression systems:

    • Express Gr77a in cell lines (e.g., HEK293T cells)

    • Perform calcium imaging upon exposure to candidate ligands

    • Use an inducible expression system to control receptor levels

  • Structure-based virtual screening:

    • Generate molecular models of Gr77a based on known receptor structures

    • Perform in silico docking of potential ligands

    • Validate top hits using functional assays

  • Comparative analysis:

    • Identify ligands for closely related GRs

    • Test these compounds on Gr77a-expressing cells or neurons

The combination of these approaches would help narrow down the chemical space and identify specific tastants detected by Gr77a, providing insights into its functional role in Drosophila chemosensation.

What are the optimal genetic tools for manipulating Gr77a expression in Drosophila?

Several genetic tools can be employed for manipulating Gr77a expression in Drosophila melanogaster:

RNA Interference (RNAi):

  • UAS-Gr77a-RNAi constructs can be obtained from repositories like the Vienna Drosophila Resource Center

  • Expression driven by specific GAL4 drivers (e.g., Gr-GAL4 lines) for tissue-specific knockdown

  • Multiple RNAi lines targeting different regions of Gr77a may be used to confirm specificity

CRISPR/Cas9 Gene Editing:

  • Generation of precise mutations or deletions in Gr77a

  • Creation of tagged versions of Gr77a for localization studies

  • Knock-in of modified versions to study structure-function relationships

GAL4/UAS System:

  • Creation of Gr77a-GAL4 driver lines to express reporters or effectors in Gr77a-expressing cells

  • UAS-Gr77a constructs for rescue experiments or overexpression studies

Temperature-sensitive Systems:

  • Combination with Gal80ts for temporal control of Gr77a manipulation

  • Allows for developmental versus acute manipulations

Mosaic Analysis:

  • FLP/FRT system to generate genetic mosaics for clonal analysis

  • Particularly useful for studying cell-autonomous functions of Gr77a

The choice of tool depends on the specific research question, with consideration for temporal and spatial precision, potential off-target effects, and compatibility with other genetic tools being used in the experimental design.

How can expression patterns of Gr77a be accurately visualized and quantified?

Accurate visualization and quantification of Gr77a expression patterns can be achieved through:

Reporter Gene Approaches:

  • Generation of Gr77a-GAL4 driver lines to express fluorescent reporters in Gr77a-positive cells

  • Direct fusion of fluorescent proteins to Gr77a, if fusion doesn't disrupt function

  • CRISPR/Cas9-mediated tagging of the endogenous Gr77a locus

Immunohistochemistry:

  • Development of specific antibodies against Gr77a

  • Use of epitope tags (FLAG, HA, etc.) if direct antibodies are unavailable

  • Double staining with markers for specific cell types or subcellular compartments

RNA Visualization:

  • Fluorescent in situ hybridization (FISH) to detect Gr77a mRNA

  • Single-molecule FISH for quantitative analysis at the single-cell level

  • RNAscope for improved sensitivity and specificity

Quantification Methods:

  • Confocal microscopy with 3D reconstruction for spatial distribution analysis

  • Flow cytometry of dissociated cells for population-level quantification

  • Quantitative PCR for expression level analysis across tissues or conditions

  • Single-cell RNA sequencing for comprehensive expression profiling

These techniques can be applied to various tissues including the labellum, tarsi, and internal gustatory organs, allowing for comprehensive mapping of Gr77a expression throughout the fly.

What is the recommended protocol for performing single sensillum recordings to measure Gr77a activity?

Single sensillum recordings (SSR) are a powerful technique for measuring the electrophysiological responses of gustatory receptor neurons expressing Gr77a. Based on protocols used for other gustatory receptors, the recommended approach would include:

Preparation:

  • House flies in standard yeast-molasses food vials prior to recordings

  • Use female flies aged 5-10 days post-eclosion for consistent results

  • Immobilize flies by mounting them on an appropriate preparation slide

Recording Setup:

  • Use filtered AC signals (200Hz-3kHz) for optimal neuron activity detection

  • Digitize signals for analysis using appropriate software (e.g., Autospike 32)

  • Position recording electrode at the base of the sensillum

  • Use a reference electrode in the eye or thorax

Stimulus Delivery:

  • Prepare tastant solutions at appropriate concentrations

  • Apply tastants either through:

    • Conventional stimulation: Place 30 μl of tastant solution on filter paper in a Pasteur pipette and deliver via airflow into a constant stream of humidified air

    • Contact stimulation: Directly touch the sensillum with a glass capillary containing the tastant solution

Data Analysis:

  • Measure spike frequency before, during, and after stimulus application

  • Calculate response magnitude as the change in spike frequency

  • Compare responses across different genotypes and conditions

  • Analyze temporal dynamics of the response

This protocol would allow for precise measurement of neuronal activity in Gr77a-expressing GRNs in response to various stimuli, providing direct evidence for Gr77a ligand specificity and function.

How can data contradictions in Gr77a research be systematically identified and resolved?

Contradictions in Gr77a research data can be systematically identified and resolved using a structured approach based on data quality assessment principles:

Contradiction Pattern Identification:

  • Apply the (α, β, θ) notation system to classify contradiction patterns :

    • α: Number of interdependent items (e.g., different experimental methods examining Gr77a function)

    • β: Number of contradictory dependencies defined by domain experts

    • θ: Minimal number of required Boolean rules to assess these contradictions

  • Create a matrix of findings from different studies to identify potential contradictions

Systematic Resolution Approaches:

  • Methodological Analysis:

    • Compare experimental protocols in detail to identify critical differences

    • Evaluate the sensitivity and specificity of different assays

    • Consider temporal, environmental, and genetic background factors

  • Genetic Background Effects:

    • Examine strain differences that might influence Gr77a function

    • Test for modifier genes using approaches like QTL mapping

    • Consider copy number variations that might affect expression levels

  • Statistical Reanalysis:

    • Apply consistent statistical methods across datasets

    • Perform meta-analysis when multiple studies are available

    • Use power analysis to determine if negative results are conclusive

  • Independent Validation:

    • Replicate key findings using multiple techniques

    • Cross-validate results using both in vivo and in vitro approaches

    • Consider cross-laboratory validation for controversial findings

Example: Resolving Contradictory Phenotypes

When contradictory phenotypes are reported for Gr77a mutations (similar to contradictions observed with Gr66a ), systematic investigation should include:

  • Verification that the mutations specifically affect only Gr77a

  • Testing whether RNAi knockdown produces the same phenotype as genetic mutations

  • Rescue experiments with wild-type Gr77a to confirm specificity

  • Examination of potential genetic background effects or flanking gene issues

This structured approach to contradiction resolution ensures that apparent discrepancies in Gr77a research can be systematically addressed, leading to more robust and reproducible findings.

How does Gr77a compare structurally and functionally to other Drosophila gustatory receptors?

Comparing Gr77a to other Drosophila gustatory receptors requires analysis at multiple levels:

Structural Comparison:

  • Sequence homology analysis with well-characterized GRs like Gr33a, Gr66a, and members of the Gr64 family

  • Prediction of transmembrane domains and structural motifs

  • Identification of conserved residues that might be critical for function

  • Molecular modeling based on known membrane protein structures

Expression Pattern Comparison:

  • Analysis of co-expression with broadly expressed GRs like Gr33a, which is found in many GRNs responding to aversive chemicals

  • Determination whether Gr77a is expressed in bitter-sensing neurons (like Gr32a, Gr33a, and Gr66a) or sweet-sensing neurons

  • Comparison with expression patterns of other GRs in specific sensilla types

Functional Comparison:

  • Assessment of whether Gr77a functions independently or requires co-receptors, similar to how GR33a may function in trafficking other GRs

  • Determination if Gr77a is involved in attractive or aversive responses

  • Comparison of ligand specificity with other GRs

  • Analysis of potential redundancy with other receptors, as observed with DEET detection mechanisms

A systematic comparative analysis would help position Gr77a within the broader context of gustation in Drosophila and potentially reveal shared mechanisms or unique properties of this receptor.

What is the current understanding of Gr77a evolution and conservation across Drosophila species?

Understanding the evolution and conservation of Gr77a across Drosophila species provides important context for functional studies:

Evolutionary Analysis:

  • Phylogenetic comparison of Gr77a sequences across Drosophila species

  • Identification of orthologs in closely and distantly related Drosophila species

  • Analysis of selection pressures using metrics such as dN/dS ratios

  • Determination if Gr77a is part of species-specific expansions or contractions within the GR family

Functional Conservation:

  • Comparison of expression patterns of Gr77a orthologs in different species

  • Cross-species functional complementation experiments

  • Behavioral assays comparing responses to putative Gr77a ligands across species

  • Analysis of species-specific adaptations in Gr77a function related to ecological niches

Structural Variation:

  • Identification of conserved domains suggesting critical functional regions

  • Analysis of species-specific variations that might relate to ligand specificity

  • Examination of copy number variation across species, similar to what has been observed for Cyp12d1

This evolutionary perspective would provide insights into the functional importance of Gr77a and help identify conserved mechanisms of taste perception across Drosophila species, potentially informing experimental approaches and interpretation of results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.