Recombinant Drosophila melanogaster Putative gustatory receptor 98a (Gr98a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr98a; GR98B.4; CG13976; Putative gustatory receptor 98a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr98a
Target Protein Sequence
MEQMSGELHAASLLYMRRLMKCLGMLPFGQNLFSKGFCYVLLFVSLGFSSYWRFSFDYEF DYDFLNDRFSSTIDLSNFVALVLGHAIIVLELLWGNCSKDVDRQLQAIHSQIKLQLGTSN STDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYCAVIL FIYQELIVGGSNVLDELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSL ITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECIKLLEIVVPCYLCTRCDAMQR KFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYI VICIQFSINFRAKKMSNEQMSQNITSTSAPI
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor involved in mediating acceptance or avoidance behavior, depending on its substrates.
Database Links

KEGG: dme:Dmel_CG13976

STRING: 7227.FBpp0084554

UniGene: Dm.27431

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Gr98a relate to other gustatory receptors in the Gr98 family?

The Gr98 family includes several members such as Gr98a, Gr98b, Gr98c, and Gr98d, each with potentially distinct expression patterns and functions. Research has shown that Gr98b, a related receptor, functions together with GR8a and GR66a in the detection of L-canavanine, a plant-derived insecticide . This suggests that members of the Gr98 family may collaborate with other GRs to form functional taste receptors. Expression analysis has documented varying neuronal expression patterns among Gr98 family members, which may indicate different roles in taste perception .

What expression patterns have been observed for Gr98a in Drosophila?

Comprehensive expression studies of gustatory receptor genes in Drosophila have been conducted using the GAL4-UAS system, as traditional in situ hybridization approaches have been largely unsuccessful due to low expression levels of these genes. This approach has enabled researchers to map the expression patterns of various gustatory receptors in different taste organs . While specific expression data for Gr98a is limited in the provided search results, research methodologies similar to those used for other gustatory receptors would likely reveal its expression in specific subsets of gustatory receptor neurons (GRNs).

How can recombinant Gr98a protein be expressed and purified for research use?

Recombinant Drosophila melanogaster Gr98a can be expressed using several host systems:

  • Cell-free expression systems for maximum control over expression conditions

  • Bacterial expression systems (E. coli)

  • Yeast expression systems

  • Baculovirus-insect cell expression systems

  • Mammalian cell expression systems

Purification typically involves affinity chromatography, taking advantage of tags such as His-tags that can be engineered into the recombinant protein. Standard purification protocols aim to achieve ≥85% purity as determined by SDS-PAGE analysis . The choice of expression system should be guided by the specific research requirements, including the need for post-translational modifications, protein folding considerations, and downstream applications.

What are the most effective approaches for studying Gr98a function in Drosophila?

Based on methodologies used to study related gustatory receptors, several approaches may be effective for investigating Gr98a function:

  • Genetic manipulation: Using GAL4-UAS system to drive expression of Gr98a in specific neurons or ectopically in other neurons to assess functional consequences.

  • Electrophysiology: Recording neuronal responses from gustatory receptor neurons expressing Gr98a when exposed to various tastants.

  • Behavioral assays: Assessing behavioral responses to different compounds in wild-type flies versus those with altered Gr98a expression.

  • Heterologous expression systems: Expressing Gr98a in cell lines (such as Drosophila S2 cells) to study receptor activation using calcium imaging or electrophysiological recordings .

  • Co-expression studies: Investigating potential interactions between Gr98a and other gustatory receptors by co-expressing them in heterologous systems or in vivo.

What antibodies are available for Gr98a detection and what applications are they suited for?

Polyclonal antibodies against Drosophila melanogaster Gr98a are available for research applications. These antibodies are typically generated in rabbits through antigen-affinity purification approaches. Available antibodies have been validated for applications including:

  • Western blotting (WB) for protein detection

  • Enzyme-linked immunosorbent assay (ELISA)

When selecting antibodies for Gr98a research, it is important to verify the specific epitope recognized and to ensure proper validation for the intended application . Cross-reactivity with other gustatory receptors should be carefully assessed, particularly given the sequence similarities within the Gr family.

How do Gr98a and other gustatory receptors form functional complexes for taste detection?

Research on related gustatory receptors provides a model for how Gr98a might function in taste perception. Studies have demonstrated that three gustatory receptors—GR8a, GR66a, and GR98b—function together to detect L-canavanine, a toxic plant compound. Misexpression of all three of these receptors in sweet-sensing GRNs can convert L-canavanine from an aversive compound to an attractive one, highlighting the combinatorial nature of taste receptor function .

When co-expressed in Drosophila S2 cells, GR8a, GR66a, and GR98b induce an L-canavanine-activated nonselective cation conductance, providing evidence for their collaborative role in forming a functional taste receptor . By analogy, Gr98a likely requires co-expression with other GRs to form functional taste receptors, though its specific partners remain to be definitively established in the literature reviewed.

What is known about the molecular structure of Gr98a and how does it influence ligand binding?

Structural studies of gustatory receptors are challenging due to their membrane-bound nature and tendency to form multimeric complexes. Advanced techniques such as cryo-electron microscopy or crystallography combined with recombinant expression systems may be necessary to elucidate the structure of Gr98a and its ligand-binding domains. Molecular modeling based on related receptors with known structures could provide preliminary insights into structure-function relationships.

How is the neural coding of Gr98a-mediated taste perception integrated into feeding behavior?

Drosophila gustatory receptor neurons (GRNs) project to the subesophageal zone (SEZ) of the brain, where taste information is processed and integrated with other sensory inputs to guide feeding decisions. Different GRN classes detecting distinct taste modalities (sweet, bitter, water, low salt, high salt) have segregated projections within the SEZ, suggesting modality-specific processing .

The integration of gustatory information occurs through circuit-level interactions in the brain. While the specific contribution of Gr98a to these circuits is not detailed in the provided search results, research on other gustatory receptors indicates that:

  • Activation of bitter-sensing neurons (expressing receptors like GR66a) typically drives rejection behavior

  • Activation of sugar-sensing neurons (expressing receptors like GR5a and GR64f) elicits acceptance behavior

  • Misexpression of specific receptors in inappropriate neuron classes can change behavioral responses to tastants

Understanding how Gr98a-expressing neurons connect within these circuits would require neuroanatomical tracing combined with functional activation/inhibition studies.

What are the critical parameters for successful recombinant expression of functional Gr98a?

Based on protocols for related membrane proteins, several critical parameters should be considered for successful expression of functional Gr98a:

  • Expression system selection: While E. coli systems may be suitable for producing protein for antibody generation, insect or mammalian expression systems may be required for obtaining properly folded, functional protein with appropriate post-translational modifications.

  • Codon optimization: Adapting the Gr98a sequence to the codon bias of the expression host can significantly improve expression levels.

  • Fusion tags: Strategic placement of affinity tags (N-terminal vs. C-terminal) and inclusion of solubility-enhancing fusion partners may improve expression and purification outcomes.

  • Expression conditions: Optimizing temperature, induction timing, and duration can help maximize protein yield while minimizing aggregation.

  • Membrane protein solubilization: Selection of appropriate detergents or lipid environments for extraction and purification is critical for maintaining protein function.

How can researchers distinguish between Gr98a and other closely related gustatory receptors in experimental systems?

Distinguishing between closely related gustatory receptors requires careful experimental design:

  • Sequence-specific tools: Design of highly specific PCR primers, probes, or CRISPR-Cas9 guide RNAs based on unique regions of the Gr98a sequence.

  • Epitope tagging: Introduction of specific epitope tags into Gr98a to enable detection with highly specific antibodies against the tag rather than relying on antibodies against the receptor itself.

  • Reporter gene constructs: Generation of Gr98a-specific GAL4 driver lines to express reporter genes exclusively in Gr98a-expressing cells.

  • Receptor-specific functional assays: Development of functional assays based on specific ligands or response properties unique to Gr98a.

  • Single-cell transcriptomics: Analysis of gene expression at the single-cell level to precisely map the expression of different gustatory receptors in individual neurons.

What are the common challenges in analyzing Gr98a function and how can they be overcome?

Several challenges frequently arise when studying gustatory receptors like Gr98a:

  • Low expression levels: Gustatory receptors often have low endogenous expression levels, making detection challenging. This can be addressed by using sensitive detection methods (RT-qPCR, RNAscope, single-cell RNA-seq) or by generating overexpression constructs.

  • Membrane protein solubilization: As membrane proteins, gustatory receptors can be difficult to extract and maintain in a functional state. Systematic screening of detergents and lipid environments may be necessary to identify optimal conditions.

  • Functional redundancy: Overlapping functions among gustatory receptors may mask phenotypes in single-receptor mutants. Generating multiple receptor mutants or using dominant negative approaches may help overcome this issue.

  • Complex receptor stoichiometry: Gustatory receptors often function in heteromeric complexes with variable composition. Combinatorial expression of different receptor subsets may be necessary to reconstitute function in heterologous systems.

  • Limited knowledge of natural ligands: The specific compounds detected by many gustatory receptors remain unknown. High-throughput screening approaches with diverse chemical libraries may help identify Gr98a ligands.

How does Gr98a compare functionally with its homologs in other Drosophila species?

While the provided search results do not contain specific information about Gr98a homologs across Drosophila species, comparative studies of gustatory receptors generally reveal important insights about functional conservation and divergence. Investigating Gr98a homologs across the Drosophila phylogeny would likely reveal:

  • Sequence conservation patterns that highlight functionally critical domains

  • Species-specific adaptations that may correlate with ecological niches and food preferences

  • Evolutionary rates that could indicate selective pressures on different receptor regions

Comparative functional analysis using heterologous expression systems would be valuable for determining whether Gr98a homologs detect similar compounds across species or have evolved to recognize distinct ligands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.