Recombinant Drosophila melanogaster Putative gustatory receptor 9a (Gr9a)

Shipped with Ice Packs
In Stock

Description

Table 1: Biochemical Properties

PropertyDetail
UniProt IDQ8IRL8
Amino Acid Sequence341 residues (MSLWLEHFLTG...FFFILEALVIFLQFVSLVRT)
Expression RegionFull-length protein (residues 1–341)
TagDetermined during production (commonly His-tag or GST for purification)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Gr9a is classified as a putative gustatory receptor due to its structural homology to other GRs, which typically have seven transmembrane domains and function as ligand-gated ion channels or G-protein-coupled receptors .

Functional Role in Chemosensation

While Gr9a’s specific ligands remain uncharacterized, insights into GR family dynamics suggest potential roles:

  • Collaborative Detection: Some GRs, like GR8a and GR98b, require co-expression with GR66a to sense bitter compounds (e.g., L-canavanine) . Gr9a may similarly operate in multimers.

  • Tissue Distribution: GRs are expressed in gustatory neurons of the labellum, legs, and ovipositor, implicating Gr9a in feeding or oviposition behaviors .

  • Evolutionary Conservation: GRs share a C-terminal signature sequence critical for ligand binding, though Gr9a’s sequence divergence hints at unique functional adaptations .

Research Applications

Recombinant Gr9a is primarily used for:

  1. Ligand-Binding Assays: To identify tastants or pheromones that activate Gr9a.

  2. Structural Studies: Mapping transmembrane domains or interaction interfaces via crystallography.

  3. Behavioral Genetics: Knockout or misexpression studies to assess Gr9a’s role in Drosophila behavior .

Table 2: Comparative GR Functions in Drosophila

GR ProteinPartner GRsLigandRole
GR66aGR8a, GR98bL-canavanine (bitter)Avoidance behavior
GR9aUnknownUndeterminedHypothesized taste sensing
GR32aGR33a, GR66aBroad-spectrum bitter compoundsAversion

Challenges and Future Directions

  • Ligand Identification: No direct studies have identified Gr9a’s ligands, necessitating high-throughput screening.

  • Expression Complexity: GRs often require co-receptors for functional expression in heterologous systems .

  • Evolutionary Insights: Gr9a’s divergence from other GRs may reflect adaptation to niche ecological stimuli .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gr9a; CG32693; Putative gustatory receptor 9a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr9a
Target Protein Sequence
MSLWLEHFLTGYFQLCGLVCGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNES VPAYFAKVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEIIL FACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGS SDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLF LFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQ DPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFVSLVRT
Uniprot No.

Target Background

Function
This protein is a probable gustatory receptor, which mediates acceptance or avoidance behavior depending on its substrates.
Database Links

KEGG: dme:Dmel_CG32693

STRING: 7227.FBpp0071355

UniGene: Dm.27626

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neurons of the terminal external chemosensory organ of larvae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.