Recombinant Drosophila melanogaster Putative mitochondrial inner membrane protein (CG6455)

Shipped with Ice Packs
In Stock

Description

General Information

CG6455 in Drosophila melanogaster is recognized as a homolog of the human Mitofilin/MIC60 protein, a core component of the mitochondrial contact site and cristae organizing system (MICOS) . The MICOS complex is crucial for maintaining mitochondrial ultrastructure, particularly the formation and stability of cristae, which are essential for efficient energy production within the mitochondria .

Function and Significance

  • Role in Mitochondrial Structure and Function The Drosophila MICOS complex, which includes Mitofilin (Dmel\CG6455), is vital for maintaining the proper structure and function of mitochondria . Knocking down the expression of genes like CG5903/MIC26-MIC27, Mitofilin/MIC60, and QIL1/MIC13 can lead to altered mitochondrial morphology, including loss of cristae junctions and disruption of cristae packing . These structural changes impair mitochondrial function, leading to reduced membrane potential and imbalances in fusion/fission processes .

  • Impact on Muscle Tissue Homeostasis Studies have demonstrated that disrupting the function of CG6455 and other MICOS components can negatively impact muscle tissue homeostasis in Drosophila . For example, knockdown flies exhibit reduced climbing ability, indicating deficits in muscle function . This highlights the importance of CG6455 in maintaining the health and functionality of muscle tissues by ensuring proper mitochondrial function .

  • Involvement in Mitochondrial Quality Control CG6455 plays a role in mitochondrial quality control by participating in the clearance of misfolded proteins and damaged mitochondria . Research indicates that when unfolded proteins accumulate in the mitochondria, it results in the activation of autophagy, a process that degrades and removes dysfunctional components . Proteins like PINK1 and Parkin work to clear mitochondria with enhanced levels of misfolded proteins by promoting their autophagic degradation .

Experimental Models and Techniques

Drosophila melanogaster serves as a valuable model organism for studying mitochondrial function and related diseases . Researchers use various techniques, including:

  • RNAi Screening: Used to knock down individual ABC transporters in specific epithelial tissues to examine changes in sensitivity to pesticides .

  • Transgenic Overexpression: Employed to study the function of P-glycoprotein family members by expressing them in Drosophila lines .

  • Immunolocalization: Used to determine the subcellular localization of proteins within tissues, such as the midgut .

  • Mitochondrial morphology analysis: оценить структуру митохондрий.

  • Analysis of mitochondrial membrane potential: оценка функциональности митохондрий.

  • mtDNA content measurement: для определения количества митохондриальной ДНК.

Data Tables

GeneHomologFunctionPhenotype when Knocked Down
CG6455Mitofilin/MIC60Core component of MICOS, maintains cristae structureAltered mitochondrial morphology, reduced membrane potential, increased mitophagy, reduced mtDNA content
CG5903MIC26-MIC27Component of MICOS, interacts with Mitofilin/MIC60 and QIL1/MIC13Similar to Mitofilin/MIC60 knockdown, altered cristae morphology, reduced membrane potential, increased mitophagy
CG7603QIL1/MIC13Component of MICOS, regulates cristae morphologyAltered mitochondrial morphology, reduced membrane potential, increased mitophagy, fragmented mitochondrial networks
PINK1PINK1Protein kinase, involved in mitochondrial quality controlHigher levels of misfolded respiratory complex components, increased mitochondrial unfolded protein response markers
ParkinParkinE3 ubiquitin ligase, promotes autophagic degradation of defective mitochondriaClearance of defective mitochondria with high levels of unfolded proteins, maintenance of viable pool of cellular mitochondria
AssayDescription
Mitochondrial Morphologyоценить структуру митохондрий, including cristae junctions and packing orientation
Mitochondrial Membrane PotentialMeasure the voltage difference across the inner mitochondrial membrane, an indicator of mitochondrial activity
mtDNA ContentDetermine the quantity of mitochondrial DNA present, which is crucial for mitochondrial function and replication
MitophagyAssess the level of selective autophagy of mitochondria, indicating the cell's response to damaged or dysfunctional mitochondria
Climbing AbilityMeasure the ability of flies to climb, a proxy for muscle function and neurological health

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mitofilin; CG6455; MICOS complex subunit Mic60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-739
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Mitofilin
Target Protein Sequence
MYRLAVRDQCKCALQRTLQQTTANNRQFGGSSSGSGGREQGRRQQEEQGQQGDQGYQGYQ SLPPHMREAGFGKVVLFVSPLAAVGGVITYAKYDDDFRKLVEKNVPGAGSVIKVALQEEP PFKGITKNVNDQIDKVKSGIETVTSTVDSVTSKVTGLFGGGSGDDKSKKSKVEPVKATPA EEKRPSKPSEVSKTEAKPVSKPAAAAAPAPAAKPKDNPLPRDVVELEKAIELSAQLAVKE YNVAIGVLKGFNDDVRKVVDKAVENGENSLWTTLKNRASARDTAVATAERAAREAQEKIV ACEIALSAAATAQNAKKVEAVRDKIKKLVDHIGNVKDELYRHKDTASVSDKYWRNVEKAR NYFIDEIESIFPGLSLADKKLNLSKEDLDLFILHAYTHVLAYQKELQRLQTDGELRLKRA IDSVRGDNDSEALRAQLEYHLEAERRKLAVENQKKIFHIHAESDKLLRLQLKKQAEAHAD HIKDIVAQRETDLTRSFKRELEDKLATEKANYKLQLAGMLGKLRGMDAALAERADAERTA NQAQALWAACQALWASVRAATPGVHYKDRLRPLKNEINAIAKVAKGDDLVAAVLESVPKE AQERGVYPEDALRERFLNVERVARRLALVPEEGAGLPIYFLSYLQSLFILRPDNPISKDE LENKPFDYSKLDTYDILNRARYHVDRSDFLQALKYMNLLQGASRKIAGEWMKEARLMLET QQAANTLMAHAAASGLLYL
Uniprot No.

Target Background

Function

Component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located in the mitochondrial inner membrane, plays a vital role in maintaining crista junctions, inner membrane architecture, and the formation of contact sites with the outer membrane.

Database Links

KEGG: dme:Dmel_CG6455

STRING: 7227.FBpp0288710

UniGene: Dm.7879

Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is CG6455 and what is its predicted function in Drosophila melanogaster?

CG6455 is annotated as a putative mitochondrial inner membrane protein in Drosophila melanogaster. The protein consists of 739 amino acids (P91928) and is predicted to localize to the mitochondrial inner membrane where it may participate in membrane organization and mitochondrial function . Based on homology studies with other species, it could potentially be involved in the formation of cristae junctions, which are critical structures for mitochondrial function and cellular energy production.

How is recombinant CG6455 typically expressed and purified for experimental studies?

For in vitro studies, recombinant full-length CG6455 can be expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The typical workflow includes:

  • Cloning the CG6455 coding sequence into an appropriate bacterial expression vector

  • Transforming E. coli cells and inducing protein expression

  • Lysing the cells and purifying the His-tagged protein using nickel affinity chromatography

  • Verifying protein integrity via SDS-PAGE and Western blotting

  • Conducting buffer exchange to prepare the protein for downstream applications

What techniques are commonly used to study the subcellular localization of CG6455?

To confirm the mitochondrial localization of CG6455, researchers typically employ:

  • Immunofluorescence microscopy using antibodies against CG6455 and co-staining with established mitochondrial markers

  • Subcellular fractionation followed by Western blotting to detect CG6455 in mitochondrial fractions

  • Expression of GFP-tagged CG6455 in Drosophila cell lines or tissues for live imaging

  • Immunogold electron microscopy to precisely localize the protein within the mitochondrial subcompartments

How does CG6455 relate to the MICOS complex in Drosophila?

While the search results don't explicitly identify CG6455 as a MICOS complex component, the MICOS complex in Drosophila is known to include proteins like CG5903/MIC26-MIC27, Mitofilin/MIC60, and QIL1/MIC13 . As a putative mitochondrial inner membrane protein, CG6455 could potentially interact with MICOS components. To determine any potential relationship, researchers typically:

  • Perform co-immunoprecipitation experiments to identify protein-protein interactions

  • Use proximity labeling techniques such as BioID to detect proteins that associate with CG6455

  • Compare phenotypes of CG6455 and known MICOS component knockdowns

  • Assess CG6455 expression and localization in MICOS knockout/knockdown models

What are the most effective methods for knocking down CG6455 expression in Drosophila?

Based on approaches used for studying other mitochondrial inner membrane proteins in Drosophila, effective knockdown strategies include:

  • RNA interference (RNAi) using the UAS-GAL4 system with tissue-specific drivers

  • CRISPR-Cas9 genome editing to generate null mutants or introduce specific mutations

  • P-element insertional mutagenesis to disrupt gene function

For RNAi approaches, researchers have achieved efficient knockdown of other mitochondrial inner membrane proteins, with transcript levels reduced to 21-33% of control levels . Similar efficiency might be expected for CG6455 knockdown experiments.

How can researchers assess mitochondrial function and structure following CG6455 manipulation?

To evaluate the impact of CG6455 knockdown or overexpression on mitochondrial function and structure, researchers can employ multiple complementary approaches:

  • Thin-section transmission electron microscopy (TEM) to examine ultrastructural changes in mitochondria, particularly cristae morphology

  • Fluorescent dyes (e.g., TMRM, MitoTracker) to assess mitochondrial membrane potential

  • Oxygen consumption measurements to evaluate respiratory function

  • Mitochondrial network analysis using confocal microscopy and image analysis software

  • mtDNA content quantification via qPCR

  • Mitophagy assessment using dual-fluorescent reporters or immunoelectron microscopy

What expression systems can be used to study CG6455 protein function beyond E. coli?

While E. coli is commonly used for producing recombinant CG6455 , alternative expression systems may better preserve post-translational modifications and protein folding:

  • Insect cell expression systems (Sf9, S2 cells) that more closely match the native Drosophila environment

  • Cell-free protein synthesis systems that can incorporate modified amino acids

  • Yeast expression systems, particularly for studying complementation with yeast MICOS components

  • Mammalian cell expression for cross-species functional analysis

Each system offers distinct advantages depending on the research question and downstream applications.

How might CG6455 contribute to mitochondrial DNA maintenance and nucleoid structure?

Studies of MICOS proteins in Drosophila have revealed that knockdown of components like Mitofilin/MIC60 affects mtDNA integrity and nucleoid structure . To investigate CG6455's potential role in this process:

  • Quantify mtDNA copy number in CG6455 knockdown tissues using qPCR

  • Visualize nucleoid morphology using DNA-binding dyes or immunofluorescence against nucleoid proteins

  • Assess mtDNA transcription levels using RT-qPCR for mitochondrial genes

  • Perform chromatin immunoprecipitation to detect any potential interaction between CG6455 and mtDNA

  • Examine the distribution of nucleoid proteins in the presence and absence of CG6455

What is the relationship between CG6455 and mitochondrial dynamics (fusion/fission)?

MICOS proteins in Drosophila influence mitochondrial fusion/fission balance . To investigate CG6455's potential role:

  • Analyze mitochondrial network morphology in CG6455 knockdown cells using confocal microscopy

  • Quantify levels and distribution of fusion/fission proteins (e.g., Mfn, Drp1) by Western blot and immunofluorescence

  • Perform live-cell imaging to track mitochondrial dynamics in real-time

  • Conduct genetic interaction studies by manipulating CG6455 in backgrounds with altered fusion/fission machinery

  • Measure the size distribution of mitochondria using electron microscopy and morphometric analysis

How do circadian rhythms affect CG6455 expression and function in different Drosophila tissues?

Given that circadian clocks can influence mitochondrial function in Drosophila , researchers might explore:

  • Monitor CG6455 expression over 24-hour cycles using qPCR or Western blotting

  • Employ the LABL (Locally Activatable BioLuminescence) reporter system to track tissue-specific circadian oscillations in CG6455 expression in vivo

  • Analyze CG6455 expression and mitochondrial function in clock mutants (e.g., per, tim, Clk)

  • Investigate whether CG6455 knockdown affects circadian behaviors or molecular oscillations

  • Compare CG6455 regulation across different tissues with varying metabolic demands

What proteomics approaches are most suitable for identifying the interactome of CG6455?

To comprehensively map the protein interaction network of CG6455:

  • Perform immunoprecipitation followed by mass spectrometry (IP-MS)

  • Use proximity labeling methods (BioID, APEX) to identify nearby proteins in the mitochondrial inner membrane

  • Conduct crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Implement split-reporter assays (BiFC, FRET) to validate specific protein-protein interactions in vivo

  • Apply isotope labeling strategies (SILAC) to quantitatively compare interactomes under different conditions

How does the function of CG6455 vary between different Drosophila tissues?

Mitochondrial proteins can have tissue-specific functions based on metabolic demands. To investigate CG6455's tissue-specific roles:

  • Perform tissue-specific knockdown using the GAL4-UAS system with drivers for different tissues

  • Compare phenotypes in high-energy tissues (indirect flight muscle, IFM) versus lower-energy tissues

  • Analyze tissue-specific expression patterns using immunohistochemistry or reporter constructs

  • Conduct tissue-specific proteomics to identify differential interaction partners

  • Examine mitochondrial morphology across tissues in CG6455 knockdown flies using electron microscopy

What is the impact of CG6455 dysfunction on muscle tissue homeostasis in Drosophila?

Based on findings from other MICOS component studies, CG6455 might affect muscle tissue function. To investigate:

How does aging affect CG6455 expression and function in Drosophila models?

Aging is associated with mitochondrial dysfunction. To study age-related changes in CG6455:

  • Compare CG6455 expression levels in young versus aged flies using qPCR and Western blotting

  • Analyze age-related changes in mitochondrial morphology in wild-type versus CG6455 knockdown flies

  • Assess whether CG6455 overexpression can rescue age-related mitochondrial defects

  • Perform lifespan analysis of CG6455 mutant or knockdown flies

  • Investigate interaction between CG6455 and known aging pathway components

What methods can identify functional homologs of CG6455 in other species?

To explore evolutionary conservation and functional homology:

  • Conduct reciprocal BLAST searches to identify potential homologs across species

  • Perform phylogenetic analysis to map evolutionary relationships

  • Analyze domain conservation using protein structure prediction tools

  • Test functional complementation by expressing CG6455 in yeast or mammalian cells lacking the putative homolog

  • Compare phenotypes of gene knockouts/knockdowns across model organisms

How do the functions of CG6455 compare with those of well-characterized MICOS components in Drosophila?

To position CG6455 within the context of known MICOS biology:

MICOS ComponentEffect of Knockdown on Mitochondrial StructureEffect on mtDNAEffect on MitophagyPotential Relation to CG6455
CG5903/MIC26-MIC27Altered cristae, fragmented networksReduced contentEnhancedComparison needed
Mitofilin/MIC60Severe cristae disruptionReduced content, fragmented nucleoidsEnhancedPotential interaction partner
QIL1/MIC13Altered cristae morphologyAffectedEnhancedComparison needed
CG6455To be determinedTo be determinedTo be determinedSubject of investigation

This comparative approach can help position CG6455 within the MICOS complex architecture and functional hierarchy .

What are the most promising techniques for real-time monitoring of CG6455 function in vivo?

For dynamic studies of CG6455 in living organisms:

  • Adapt the LABL (Locally Activatable BioLuminescence) system to monitor CG6455 expression patterns in real-time

  • Develop FRET-based sensors to detect conformational changes or interactions

  • Implement optogenetic approaches to manipulate CG6455 function with spatial and temporal precision

  • Apply correlative light and electron microscopy (CLEM) to link dynamic behaviors with ultrastructural contexts

  • Develop tissue-specific, inducible expression systems to control CG6455 levels at defined time points

How might understanding CG6455 function contribute to broader research on mitochondrial diseases?

By elucidating the role of CG6455 in Drosophila, researchers can:

  • Identify potential disease-related functions of homologous proteins in humans

  • Use Drosophila as a model to test therapeutic approaches for mitochondrial disorders

  • Discover new mechanisms of mitochondrial homeostasis that may be conserved across species

  • Develop biomarkers for mitochondrial dysfunction based on CG6455 interactions or modifications

  • Establish new assays for drug screening targeting mitochondrial inner membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.