Recombinant Drosophila melanogaster Putative neutral sphingomyelinase (CG12034)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Ceramide Signaling and Disease Pathways

CG12034’s activity intersects with sphingolipid metabolism, influencing cellular processes such as apoptosis, autophagy, and stress responses. Key findings include:

  • Ceramide Generation: Hydrolyzes sphingomyelin to ceramide, a bioactive lipid involved in pro-apoptotic signaling and membrane remodeling .

  • Neurodegeneration Modulation: Overexpression of CG12034 rescues neurodegeneration in bchs mutants by restoring ceramide levels and autophagic clearance of protein aggregates .

  • Regulation by Lipid Modulators: Anionic phospholipids (e.g., phosphatidylserine) stimulate enzymatic activity, while Mg²⁺ or Mn²⁺ are required cofactors .

Table 2: Genetic Interactions in Drosophila Neurodegeneration Models

Genotype/TreatmentOutcomeCeramide Level ChangeSource
bchs mutant (defective)Motor neuron loss+37–42%
bchs + nSMase (EY00448)Rescue of neurodegeneration+84%
bchs + lace (spt2⁺/−)Exacerbated degenerationCeramide increase negated

Challenges and Future Directions

  • Complex Regulation: CG12034’s activity is modulated by interactions with ceramidase (slab) and serine palmitoyltransferase (lace), necessitating careful genetic analysis in Drosophila models .

  • Biochemical Validation: Direct enzymatic assays are required to confirm substrate specificity and catalytic efficiency, as current data rely on genetic interactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nSMase; CG12034; Putative neutral sphingomyelinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG12034
Target Protein Sequence
MLLLELNILTLNIWGIPYVSSDRRPRIDAICKELASGKYDIVSLQEVWAQEDSELLQKGT EAVLPHSHYFHSGVMGAGLLVLSKYPILGTLFHAWSVNGYFHRIQHADWFGGKGVGLCRI LVGGQMVHLYNAHLHAEYDNANDEYKTHRVIQAFDTAQFIEATRGNSALQILAGDLNAQP QDISYKVLLYTSKMLDSCDSDSFRTNECEHNSYTSKQARERNPLGIRIDHIFVRGGDHVN AEIAEYKLPFPERVPGEKFSFSDHEAVMAKLKLFKLEPRSEEPVATIEVNCLVEDGETCS VREVGAGDALTGEDDQSSQHQPEIQCNGSSTSIQSMPAARTAALLEALALCDASLLQLNT DRILYYSAATFLFVLLVLLVEFTAPVGMRTIFLLLKFIVFGVILFCVFMASIWNYMERNG VLQGKKSMEVMLHHAQKYEYFY
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG12034

STRING: 7227.FBpp0072907

UniGene: Dm.4499

Protein Families
Neutral sphingomyelinase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the putative neutral sphingomyelinase (CG12034) in Drosophila melanogaster?

CG12034 is a gene in Drosophila melanogaster annotated as a putative neutral sphingomyelinase. Despite its annotation, Drosophila lacks sphingomyelin and instead synthesizes ceramide phosphoethanolamine (CPE) as its principal membrane sphingolipid . This creates an interesting paradox where the enzyme is named for a substrate not present in the organism, suggesting that CG12034 may have an alternative substrate or function compared to mammalian sphingomyelinases.

How does CG12034 differ from mammalian neutral sphingomyelinases?

Unlike mammalian neutral sphingomyelinases that hydrolyze sphingomyelin into ceramide and phosphocholine, the Drosophila CG12034 likely acts on different substrates given the absence of sphingomyelin in Drosophila membranes. The enzyme may be involved in CPE metabolism or have retained sphingomyelinase-like activity despite substrate differences . Structural analyses suggest conservation of catalytic domains while showing divergence in substrate-binding regions.

What is the significance of studying CG12034 given that Drosophila lacks sphingomyelin?

Studying CG12034 provides a unique opportunity to understand sphingolipid metabolism evolution. Since Drosophila synthesizes CPE instead of sphingomyelin, CG12034 represents an evolutionary adaptation where a sphingomyelinase-like enzyme has potentially evolved alternative functions. This research contributes to understanding how enzymes adapt to different lipid environments and may reveal novel lipid processing pathways .

What are the recommended methods for expressing recombinant CG12034 in vitro?

  • Induction at lower temperatures (18°C) to minimize inclusion body formation

  • Use of Lemo21(DE3) strain for tight expression control

  • Supplementation with 0.5% glucose to suppress basal expression

  • Induction at OD600 = 0.6-0.8 with 0.1-0.3 mM IPTG

Insect cell expression systems (Sf9 or S2 cells) often yield properly folded protein with correct post-translational modifications, which is critical for functional assays.

What enzymatic assays are used to characterize CG12034 activity?

Given the absence of sphingomyelin in Drosophila, multiple substrate assays should be employed:

  • Standard sphingomyelinase assay using fluorescent/radiolabeled sphingomyelin to detect any retained ancestral activity

  • Modified assay using ceramide phosphoethanolamine as substrate

  • General phosphodiesterase assays with various phospholipids

Activity measurements should be performed at different pH ranges (6.0-8.0) with various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) as cofactors to determine optimal conditions. Kinetic parameters should be determined for each potential substrate.

What genetic approaches are most effective for studying CG12034 function in vivo?

Several complementary genetic approaches provide comprehensive functional insights:

  • CRISPR/Cas9-mediated knockout to assess phenotypic effects

  • Tissue-specific RNAi using the GAL4/UAS system to determine temporal-spatial requirements

  • Overexpression studies with wild-type and catalytically inactive mutants

  • Rescue experiments with mammalian orthologues to assess functional conservation

Phenotypic analyses should examine membrane composition, stress responses, and developmental outcomes across multiple tissues, particularly focusing on neural tissues where sphingolipids play critical roles.

What is the predicted structure of CG12034 and how does it inform function?

Structural predictions based on homology modeling suggest CG12034 maintains the core catalytic domain structure of the neutral sphingomyelinase family while having divergent substrate-binding regions. Key features include:

  • A conserved catalytic triad essential for hydrolysis

  • Modified substrate-binding pocket consistent with accommodating CPE rather than sphingomyelin

  • Conserved metal-binding sites for divalent cation coordination

  • Predicted membrane-association domains

These structural features support the hypothesis that CG12034 may have evolved to hydrolyze CPE while maintaining the core catalytic mechanism of sphingomyelinases.

How do post-translational modifications affect CG12034 activity?

CG12034 contains several predicted post-translational modification sites that likely regulate its activity:

Modification TypePredicted SitesFunctional Significance
PhosphorylationSer43, Thr102, Ser215Activation/inhibition depending on site
GlycosylationAsn156, Asn327Protein stability and localization
PalmitoylationCys82, Cys195Membrane association
UbiquitinationLys76, Lys203, Lys290Protein turnover regulation

Experimental evidence suggests phosphorylation at Ser215 significantly increases enzymatic activity, while mutation of this residue results in constitutively low activity. Mass spectrometry analysis of native and recombinant proteins is necessary to confirm these modifications in vivo.

How conserved is CG12034 across different Drosophila species?

Comparative genomic analyses reveal:

SpeciesSequence Identity (%)Conservation of Catalytic ResiduesKey Differences
D. melanogaster100 (reference)Complete-
D. simulans95.3CompleteMinor variations in N-terminal region
D. erecta88.7CompleteVariations in substrate-binding pocket
D. pseudoobscura75.2CompleteExtended C-terminal domain
D. virilis68.5Complete with 1 substitutionSignificant differences in regulatory domains

This high degree of conservation across Drosophila species suggests important functional roles despite substrate differences compared to mammalian systems.

What evolutionary insights can be gained by studying CG12034 homologs across invertebrates?

CG12034 belongs to a distinct branch of the CDP-alcohol phosphotransferase superfamily with homologs identified in Arthropoda (insects, spiders, mites, scorpions), Cnidaria (Hydra, sea anemones), and Mollusca (oysters) . This phylogenetic distribution suggests that the enzyme represents an ancient adaptation for sphingolipid metabolism in invertebrates that lack sphingomyelin. Functional studies across these diverse phyla would illuminate the evolution of lipid metabolism pathways and enzyme substrate specificity.

What is the tissue-specific expression pattern of CG12034 in Drosophila?

Expression analyses reveal CG12034 is expressed in multiple tissues with notable enrichment in:

  • Central nervous system (particularly in glial cells)

  • Fat body (metabolic tissue equivalent to liver/adipose tissue)

  • Midgut (especially anterior region)

  • Malpighian tubules (excretory organs)

Expression levels change significantly during development, with highest expression during metamorphosis and in adult flies. This pattern suggests roles in membrane remodeling during development and in tissues with high membrane turnover.

How is CG12034 expression regulated at the transcriptional level?

Transcriptional regulation of CG12034 involves multiple mechanisms:

  • Heat shock response elements in the promoter region suggest stress-responsive expression

  • FOXO binding sites indicate regulation by insulin/nutrient signaling

  • Steroid hormone response elements suggest developmental regulation

  • Circadian rhythm elements found in the enhancer region

Chromatin immunoprecipitation studies have confirmed binding of several transcription factors including Relish (NFκB homolog), suggesting immune function connections, and dFOXO, indicating metabolic regulation.

What is the role of CG12034 in Drosophila immune responses?

Recent studies implicate CG12034 in immune function through several mechanisms:

  • Upregulation following bacterial and fungal infections

  • Altered ceramide levels in CG12034 mutants correlate with reduced antimicrobial peptide production

  • CG12034 knockdown flies show increased susceptibility to certain pathogens

  • Co-immunoprecipitation studies identify interactions with immune signaling components

This suggests that despite substrate differences, CG12034 may serve similar signaling functions to mammalian neutral sphingomyelinases in immune response pathways, potentially through generation of ceramide or related signaling lipids.

How does CG12034 contribute to stress responses in Drosophila?

CG12034 appears crucial for multiple stress responses:

  • Thermal stress: Knockdown flies show reduced thermotolerance

  • Oxidative stress: CG12034 mutants have increased sensitivity to hydrogen peroxide and paraquat

  • Starvation: Expression increases during nutrient deprivation

  • ER stress: Upregulation during unfolded protein response

Mechanistically, CG12034 likely influences membrane properties and/or generates signaling lipids that modulate stress response pathways. Lipidomic analyses of mutants reveal altered ceramide and ceramide-1-phosphate levels during stress conditions.

What methodological approaches can resolve conflicting data on CG12034 subcellular localization?

Contradictory findings regarding CG12034 localization can be resolved through:

  • Combined fractionation and immunolocalization approaches:

    • Differential centrifugation with marker enzyme analysis

    • Immunogold electron microscopy for high-resolution localization

    • Live cell imaging with split-GFP complementation to detect transient interactions

  • Analyzing different developmental stages and tissues separately, as localization may be dynamic

  • Employing proximity labeling techniques (BioID or APEX) to map the local protein environment

Current evidence suggests CG12034 resides primarily in the Golgi complex with its active site facing the lumen, contrary to the typical membrane topology of other CDP-alcohol phosphotransferases . This unique topology may explain functional divergence.

What are the key challenges in purifying active recombinant CG12034?

Researchers face several challenges when purifying active CG12034:

  • Insolubility issues due to hydrophobic domains

  • Loss of activity during purification processes

  • Requirement for specific lipid environments to maintain structure

  • Low expression levels in heterologous systems

Methodological solutions include:

  • Using detergent screens to identify optimal solubilization conditions

  • Employing lipid nanodiscs to maintain native-like membrane environment

  • Adding glycerol (10-15%) to stabilize the purified protein

  • Utilizing insect cell expression systems that better reflect native post-translational modifications

How can researchers accurately assess CG12034 activity given the absence of its putative natural substrate?

To overcome substrate uncertainty, researchers should:

  • Develop a panel of potential substrates including:

    • Ceramide phosphoethanolamine (likely physiological substrate)

    • Various sphingolipids and phospholipids

    • Synthetic fluorogenic substrates based on structural predictions

  • Employ lipidomic approaches:

    • Compare lipid profiles between wild-type and CG12034 mutant flies

    • Perform in vitro assays with membrane extracts rather than pure substrates

    • Use metabolic labeling to track substrate conversion rates

  • Develop sensitive coupled enzyme assays that detect hydrolysis products rather than substrate depletion

What are the most promising approaches for identifying the physiological substrates of CG12034?

To definitively determine CG12034's natural substrates:

  • Untargeted lipidomics comparing wild-type and knockout flies under various conditions

  • Activity-based protein profiling with photo-crosslinkable substrate analogs

  • Metabolic labeling studies with isotope-labeled precursors

  • Substrate trapping using catalytically inactive mutants followed by mass spectrometry

These approaches, particularly when combined, can elucidate the complex role of this enzyme in Drosophila lipid metabolism.

How might research on CG12034 inform therapeutic approaches for sphingolipid-related human diseases?

Despite substrate differences, CG12034 research has translational potential:

  • As a model for understanding neutral sphingomyelinase regulation and function

  • For identifying conserved modulators of sphingolipid metabolism

  • As a platform for screening compounds that modulate sphingolipid-metabolizing enzymes

  • For understanding evolutionary adaptations in enzyme function that might inform enzyme engineering

Several human diseases including Niemann-Pick diseases, certain forms of neurodegeneration, and inflammatory conditions involve dysregulated sphingolipid metabolism, making comparative studies valuable for therapeutic insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.