Recombinant Drosophila melanogaster Putative odorant receptor 19a (Or19a)

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant Drosophila melanogaster Putative Odorant Receptor 19a (Or19a)

Recombinant Drosophila melanogaster Putative odorant receptor 19a (Or19a) is a transmembrane protein expressed in E. coli through heterologous systems . It belongs to the odorant receptor (OR) family in Drosophila melanogaster, which plays a critical role in detecting volatile organic compounds (VOCs), particularly terpenes and related molecules . The recombinant version retains the structural and functional features of the native protein, enabling its use in biochemical assays, ligand-binding studies, and functional deorphanization .

Cross-Species Relevance

  • D. suzukii OR19A1 responds to alcohols, ketones, terpenes, and esters .

  • OR19A2 shows higher baseline firing rates but remains functionally uncharacterized due to system limitations .

Challenges in Functional Deorphanization

While Or19a has been well-characterized in D. melanogaster, heterologous systems face limitations:

  • ab3A Neuron System: Limited success with OR19A2 due to co-receptor dependency or misfolding .

  • Co-receptor Overlap: Ir25a co-expression in Orco+ neurons may confound ligand specificity assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or19a; CG18859; Odorant receptor 19a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or19a
Target Protein Sequence
MDISKVDSTRALVNHWRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNL LQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQIIM AGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLH TTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTE TLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPIS MKTFTVMIKGAYTMLTLLNEIRKTSLE
Uniprot No.

Target Background

Function
Odorant receptor mediating acceptance or avoidance behavior depending on its substrates. The odorant receptor repertoire encodes a diverse array of odor stimuli varying in identity, intensity, and duration. It may form a complex with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability. Involved in the preference for citrus fruits for oviposition, particularly through the response to valencene, the primary ligand of Or19a. Larvae reared on citrus fruits experience a reduced risk of parasitism as endoparasitoid wasps, which parasitize larvae, are strongly repelled by the smell of citrus, including valencene.
Database Links

KEGG: dme:Dmel_CG18859

STRING: 7227.FBpp0070028

UniGene: Dm.27529

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in ai2A olfactory sensory neurons in the antenna.

Q&A

What is Drosophila melanogaster odorant receptor 19a (Or19a)?

Or19a is a putative odorant receptor expressed in Drosophila melanogaster olfactory sensory neurons (OSNs). It belongs to the odorant receptor family, which mediates olfactory signal transduction. The receptor consists of 387 amino acids and is encoded by the Or19a gene (also known as CG18859) . Or19a is notably expressed in the ai2 sensillum in the Drosophila antenna, where it plays a crucial role in detecting specific environmental odors .

What are the known ligands for Or19a?

Based on the research literature, Or19a has been shown to respond primarily to the following odorants:

OdorantResponse StrengthExperimental MethodReference
ValenceneStrong (substantial activation with strong increase in firing rate)Single Sensillum Recording (SSR)Dweck et al., 2013
Geranyl acetateModerate (significant decrease in gene transcription after exposure)DREAM techniqueReported in result

Valencene appears to be the most specific ligand for Or19a, as exposure to valencene decreased Or19a mRNA levels substantially and exclusively in DREAM experiments, without affecting other tested ORs .

How does the ligand specificity of Or19a compare to other Drosophila odorant receptors?

Or19a represents a medium-specificity receptor within the Drosophila OR repertoire. While it shows strong specificity for valencene, it also responds to high concentrations of geranyl acetate. This contrasts with narrowly tuned receptors like Or49b (specific to guaiacol) and broadly tuned receptors that respond to multiple chemical classes. The specificity profile of Or19a makes it a valuable model for studying receptor-ligand interactions in medium-specificity olfactory receptors .

How can the DREAM technique be used to study Or19a function?

The DREAM (Deorphanization of Receptors based on Expression Alterations of mRNA levels) technique can be effectively used to study Or19a as follows:

Methodology:

  • Expose flies (0-3 hours old) to high concentrations of potential ligands (typically 5% v/v in an appropriate solvent) for 5 hours

  • Transfer flies to clean vials and freeze at -80°C for 5 minutes

  • Collect 50 fly heads (1:1 male-female ratio)

  • Extract RNA using TRIzol

  • Perform qRT-PCR to measure changes in Or19a mRNA levels

  • Identify ligands that cause significant downregulation of Or19a expression

In validation studies, exposure to valencene resulted in substantial and selective downregulation of Or19a mRNA levels, confirming its role as a specific ligand .

What are the advantages and limitations of using Single Sensillum Recording (SSR) versus DREAM for Or19a characterization?

AspectSingle Sensillum Recording (SSR)DREAM Technique
Temporal resolutionHigh (real-time responses)Low (responses measured after 5 hours)
ThroughputLow (one sensillum at a time)High (multiple ORs can be assessed simultaneously)
Direct evidence of activationYes (measures neuronal firing)Indirect (measures transcript changes)
Equipment requirementsSpecialized electrophysiology setupStandard molecular biology equipment
SensitivityHigh (can detect responses to 10⁻⁴ dilutions)Moderate (typically uses 5% concentrations)
Specificity for Or19aRequires knowledge of which sensillum houses Or19aCan directly measure Or19a transcript changes

SSR is more appropriate for detailed electrophysiological characterization of Or19a responses, while DREAM provides a higher-throughput approach for initial ligand identification .

How does the odorant co-receptor Orco affect Or19a expression?

Orco (Odorant receptor co-receptor) plays a crucial role in maintaining Or19a expression. Studies using the Orco² mutant flies revealed:

  • Approximately 30% loss of Or19a at the mRNA level compared to wild-type flies

  • A 36% decrease in the number of RFP-positive cells in Orco² flies compared to wild-type controls when using Or19a-GAL4 to drive the G-TRACE system

  • Despite reduced expression, most Or19a-expressing neurons are retained rather than undergoing degeneration

This indicates that Orco is necessary for maintaining normal expression levels of Or19a, though its absence doesn't lead to complete loss of the receptor or widespread degeneration of the neurons that express it .

What is the relationship between ligand binding and Or19a transcriptional regulation?

Research using the DREAM technique has revealed a feedback mechanism between ligand binding and Or19a gene expression:

  • Exposure to valencene (a specific ligand) substantially decreases Or19a mRNA levels

  • This downregulation appears to be selective, as other odorant receptor genes remain unaffected

  • The mechanism likely involves odorant-induced activation of the receptor followed by negative feedback on gene transcription

This relationship provides a biological basis for the DREAM technique and suggests that receptor activation can modulate its own expression levels, potentially as a mechanism for olfactory adaptation .

How can genetic tools be used to visualize and track Or19a-expressing neurons?

Several genetic approaches can be employed to visualize Or19a-expressing neurons:

  • Or19a-GAL4 driver lines:

    • Can be combined with UAS-reporter constructs (GFP, RFP) for direct visualization

    • Useful for anatomical mapping of Or19a-expressing neurons

  • G-TRACE lineage labeling technique:

    • Combines Or19a-GAL4 with the G-TRACE system

    • Real-time expression labels cells with nuclear RedStinger

    • Cells that have ever expressed GAL4 are permanently labeled with nuclear EGFP

    • Particularly valuable when receptor expression levels fluctuate

    • Can identify cells that transiently expressed Or19a during development

  • MARCM (Mosaic Analysis with a Repressible Cell Marker):

    • Allows for single-cell labeling and genetic manipulation of Or19a neurons

    • Can be used to study cell-autonomous functions of genes affecting Or19a

The G-TRACE system is especially valuable for tracking Or19a-expressing neurons in Orco mutant backgrounds where Or19a expression levels may be reduced .

What approaches can be used to study functional polymorphisms in Or19a?

To investigate Or19a polymorphisms and their functional consequences:

  • Sequence natural alleles from populations:

    • PCR amplify and sequence Or19a from different Drosophila lines

    • Identify single nucleotide polymorphisms (SNPs) and haplotypes

    • Analyze for signatures of selection and linkage disequilibrium

  • Associate polymorphisms with behavioral variation:

    • Test behavioral responses to valencene and other ligands across fly lines

    • Perform association studies between Or19a polymorphisms and behavioral responses

    • Validate associations by testing responses to structurally similar odorants (e.g., acetophenone)

  • Functional expression studies:

    • Express different Or19a variants in heterologous systems

    • Measure receptor activation using calcium imaging or electrophysiology

    • Correlate functional differences with specific polymorphisms

Research on odorant receptor polymorphisms has already shown associations between sequence variants in Or genes and variation in behavioral responses to odorants like benzaldehyde .

What factors should be considered when designing experiments with recombinant Or19a protein?

When working with recombinant Or19a protein:

  • Storage conditions:

    • Store at -20°C for regular use

    • For extended storage, maintain at -20°C or -80°C

    • Avoid repeated freezing and thawing cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer composition:

    • Use Tris-based buffer with 50% glycerol optimized for Or19a

    • Buffer composition is critical for maintaining protein stability and function

  • Expression considerations:

    • Tag selection should be optimized for the specific application

    • Expression region (1-387) covers the full-length protein

    • Purification strategy should minimize disruption of protein structure

  • Functional assays:

    • Consider membrane incorporation strategies for this transmembrane protein

    • Verify proper folding and orientation before ligand binding studies

How can researchers address potential AI influence in survey-based studies of olfactory perception?

With the increasing use of AI tools by research participants, studies involving human olfactory perception surveys should implement these safeguards:

  • Detect AI-generated responses:

    • Look for suspiciously well-formulated answers with fewer typos

    • Be alert to unusually lengthy responses (genuine participants typically write 4-5 sentences maximum)

    • Watch for abnormally positive or "nice" responses lacking the normal levels of snark

  • Survey design modifications:

    • Include attention checks that require human perceptual judgment

    • Add questions requiring personal olfactory experiences difficult for AI to fabricate

    • Implement time tracking to detect unusually fast completion times

  • Statistical approaches:

    • Develop algorithms to flag potential AI-generated responses

    • Compare response patterns between verified human and suspected AI responses

    • Consider robustness checks excluding suspicious responses

Recent research indicates nearly one-third of online survey participants report using large language models like ChatGPT for survey responses, potentially compromising research validity .

What are promising areas for future Or19a research?

Several research directions hold particular promise for advancing our understanding of Or19a:

  • Structural biology approaches:

    • Determining the 3D structure of Or19a through cryo-EM or X-ray crystallography

    • Using structural data to model ligand binding mechanics

    • Comparing Or19a structure with other odorant receptors to identify functional domains

  • Systems neuroscience investigations:

    • Mapping the complete neural circuit from Or19a-expressing neurons to behavior

    • Using optogenetics to selectively activate Or19a neurons and analyze behavioral outcomes

    • Examining how Or19a signals integrate with other sensory inputs

  • Evolutionary studies:

    • Comparing Or19a function across Drosophila species

    • Analyzing selective pressures on Or19a in different ecological niches

    • Investigating the co-evolution of Or19a with its ligands in natural environments

  • Translational applications:

    • Developing Or19a-based biosensors for detecting specific compounds

    • Exploring the potential of Or19a ligands for insect control strategies

    • Using insights from Or19a to understand mammalian olfactory receptor function

How might new technologies enhance the study of Or19a function?

Emerging technologies offer exciting possibilities for Or19a research:

  • Single-cell RNA sequencing:

    • Profiling transcriptomes of individual Or19a-expressing neurons

    • Identifying co-expressed genes that may influence Or19a function

    • Mapping developmental trajectories of Or19a neurons

  • CRISPR-based approaches:

    • Creating precise Or19a mutations to study structure-function relationships

    • Developing Or19a knock-in reporter lines for enhanced visualization

    • Using CRISPRa/CRISPRi to modulate Or19a expression levels

  • Advanced imaging techniques:

    • Applying voltage imaging to visualize Or19a neuron activity in real-time

    • Using expansion microscopy to examine Or19a subcellular localization

    • Implementing calcium imaging with cellular resolution to map Or19a circuit activity

  • Computational modeling:

    • Developing in silico models of Or19a-ligand interactions

    • Predicting novel ligands through machine learning approaches

    • Simulating the contribution of Or19a to olfactory coding at the network level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.