Recombinant Drosophila melanogaster Putative odorant receptor 19b (Or19b)

Shipped with Ice Packs
In Stock

Description

Expression and Localization

  • Tissue Specificity: Predominantly expressed in olfactory sensory neurons (OSNs) of the antennae and maxillary palps .

  • Co-Expression Patterns:

    • Found in neurons co-expressing Ir25a, a co-receptor for ionotropic receptors (IRs), suggesting potential cross-family functional interactions .

    • Downregulated in Obp56h RNAi males, implicating regulatory crosstalk between odorant-binding proteins (OBPs) and ORs .

Functional Insights

Odorant Recognition:

  • Putative Ligands: Indirect evidence links Or19b to hydrophobic compounds, though specific ligands remain uncharacterized .

  • Structural Determinants: Residues 142–150 in TMS3 and ECL2 are critical for odorant-induced activation, as shown in homologous receptors (e.g., OR85b) .

Behavioral Relevance:

  • Mating Behavior: Reduced Or19b expression correlates with altered cuticular hydrocarbon (CHC) profiles in D. melanogaster, including decreased 5-tricosene (5-T), a pheromone prolonging courtship latency .

  • Genetic Interactions:

    • Co-regulated with Obp19b and lush (OBP76a), suggesting a network of chemosensory genes modulating olfactory signaling .

Research Applications

  • ELISA & Binding Assays: Recombinant Or19b is used to study ligand-receptor interactions (e.g., competitive binding with 2-nonanone) .

  • Gene Expression Studies: Serves as a marker for olfactory neuron mapping and CRISPR/Cas9-based functional screens .

Unresolved Questions

  • Ligand Specificity: No direct binding assays confirm Or19b’s native ligands.

  • Ion Channel Mechanism: Unlike OR-Orco complexes, Or19b’s role in ionotropic signaling remains unverified.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or19b; CG32825; Putative odorant receptor 19b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or19b
Target Protein Sequence
MDISKVDSTRALVNHWRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNL LQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGEMISSHWLLRLLDKRLGCADERQIIM AGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWKDSTSAYLATAMLH TTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTE TLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPIS MKTFTVMIKGAYTMLTLLNEIRKTSLE
Uniprot No.

Target Background

Function
This odorant receptor mediates acceptance or avoidance behavior in Drosophila melanogaster, depending on the specific substrates it encounters. The odorant receptor repertoire encompasses a wide range of odor stimuli, differing in identity, intensity, and duration. Or19b may form a complex with Orco, creating odorant-sensing units that enable sensitive and prolonged odorant signaling, accompanied by calcium permeability.
Database Links

KEGG: dme:Dmel_CG32825

STRING: 7227.FBpp0070002

UniGene: Dm.28182

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative odorant receptor Or19b in Drosophila melanogaster?

Or19b is a putative odorant receptor gene expressed in specific olfactory sensory neurons (OSNs) in Drosophila melanogaster. It belongs to the larger family of chemosensory receptors that enable flies to detect and respond to chemical stimuli in their environment. Or19b has been identified as part of the complex olfactory system that mediates important behaviors including food location, mate selection, and predator avoidance. Expression of Or19b has been found to be influenced by the regulation of odorant binding proteins (Obps), particularly showing reduced expression in males when Obp56h expression is inhibited .

How is Or19b functionally related to other chemoreception genes in Drosophila?

Or19b functions within an interconnected network of chemoreception genes. Research indicates that Or19b expression is linked to odorant binding protein regulation, particularly Obp56h. When Obp56h expression is inhibited through RNAi knockdown, male Drosophila melanogaster show reduced expression of both Obp19b and Or19b . This suggests a regulatory relationship where Obp56h influences Or19b expression. The expression patterns of multiple chemoreception genes appear coordinated, as inhibition of Obp56h also causes upregulation of other genes including lush in both sexes and Obp83ef specifically in females . This interconnected regulation suggests that Or19b functions as part of a larger chemosensory network rather than in isolation.

What experimental systems are available for studying odorant receptors like Or19b in Drosophila melanogaster?

Several experimental systems are available for studying odorant receptors in Drosophila melanogaster:

  • High-throughput imaging and microfluidic platforms: These systems allow for simultaneous detection of odorant-evoked calcium responses across thousands of olfactory sensory neurons (OSNs). Such platforms enable the identification of OSNs with rare response patterns and facilitate screening across the majority of the olfactory receptor space .

  • RNAi knockdown approaches: Targeted knockdown of specific genes, such as demonstrated with Obp56h, can reveal functional relationships between odorant receptors and other chemosensory components .

  • Whole genome RNA sequencing: This technique allows for comprehensive analysis of transcriptional changes following genetic manipulation, enabling researchers to identify broader effects on gene expression networks .

  • In situ hybridization: Methods similar to those used for other Drosophila genes (as demonstrated with tRNA genes ) can be applied to localize Or19b expression patterns within tissues.

  • Calcium imaging: This approach allows visualization of neuronal activity in response to odor stimulation, particularly useful for characterizing odorant receptor function.

How can calcium imaging be optimized for studying Or19b response properties?

Calcium imaging optimization for Or19b research requires careful attention to several methodological factors:

Recommended Protocol:

  • Isolated OSN preparation: Use microfluidic devices to trap and maintain isolated OSNs expressing Or19b. This approach allows for controlled odorant exposure while minimizing cross-activation from neighboring cells .

  • Calcium indicator selection: Employ genetically encoded calcium indicators (GECIs) with appropriate sensitivity and kinetics for detecting potential rapid or subtle responses characteristic of Or19b-expressing neurons.

  • Odorant delivery system: Implement precise, time-controlled microfluidic delivery systems capable of rapid solution exchange (≤500ms) to accurately measure response dynamics .

  • Screening approach: Begin with odorant cocktails to efficiently identify potential ligands, followed by testing individual compounds to determine specific response profiles. This strategy is particularly effective for identifying OSNs with rare response patterns, which may include Or19b-expressing neurons .

  • Response quantification: Establish standardized analysis protocols for quantifying response amplitude, duration, and adaptation characteristics to enable cross-study comparisons.

This methodology enables identification of OSNs with specific response patterns and permits subsequent retrieval of individual neurons for RT-PCR and gene expression analysis .

What are the genetic approaches for manipulating Or19b expression in Drosophila melanogaster?

Genetic manipulation of Or19b expression can be accomplished through several sophisticated approaches:

TechniqueApplication to Or19bAdvantagesLimitations
RNAi knockdownTarget-specific reduction of Or19b expressionRelatively simple implementation, tissue-specific knockdown possibleIncomplete gene silencing, potential off-target effects
CRISPR/Cas9 editingPrecise modification or deletion of Or19b genePermanent genetic change, complete gene knockout possiblePotential developmental compensation, phenotype may differ from acute knockdown
UAS-Gal4 expression systemControlled overexpression or rescue of Or19b in specific tissuesTemporal and spatial control of expressionOverexpression might not reflect physiological conditions
QTL mappingIdentification of natural variants affecting Or19b functionReveals natural genetic modifiersComplex analysis, requires diverse genetic backgrounds
Recombination-based approachesIntroduction of reporter constructs or protein tagsVisualization of expression patterns and protein localizationMay affect protein function, careful validation needed

Based on previous research with other chemoreception genes, a combined approach of RNAi knockdown followed by whole genome RNA sequencing provides a comprehensive understanding of both immediate effects on Or19b expression and broader transcriptional changes in related pathways .

How does recombination influence genetic studies of Or19b in Drosophila melanogaster?

Recombination patterns significantly impact genetic studies of Or19b through several mechanisms:

  • Chromosomal location effects: Recombination rates vary dramatically across the Drosophila melanogaster genome, with up to 15-to-20-fold variation between adjacent 100-kb windows . Understanding the local recombination landscape surrounding the Or19b locus is crucial for designing mapping studies.

  • Sex-specific considerations: Recombination is absent in male Drosophila melanogaster , necessitating female-specific crossing strategies when designing genetic experiments involving Or19b.

  • Hotspot influences: The presence of recombination hotspots near Or19b could affect linkage disequilibrium patterns, potentially complicating association studies between Or19b variants and phenotypic traits .

  • Experimental design implications: Researchers must account for chromosomal arm identity when designing crosses, as recombination rates are known to vary between chromosome arms .

  • Mapping resolution: The high-resolution mapping techniques described for Drosophila melanogaster (with median distance to nearest informative SNP of approximately 2.0 kb) provide sufficient precision for fine genetic manipulation of the Or19b locus.

Researchers working with Or19b should incorporate these recombination considerations into experimental design, particularly when creating recombinant lines or performing quantitative trait analysis.

What is known about the putative ligands for Or19b and methods for their identification?

Current knowledge about Or19b ligands remains limited, though methodological approaches for their identification are well-established:

  • Candidate ligand approach: Based on the association between Or19b and mating behavior regulation, pheromone compounds represent potential ligands. The cuticular hydrocarbon 5-tricosene (5-T), known to function as an inhibitory sex pheromone that increases copulation latency, may interact with Or19b, particularly given the observed coordinated expression changes with Obp56h .

  • High-throughput screening methodology: The most efficient approach employs microfluidic devices coupled with calcium imaging to screen diverse odorant panels. This technique allows for:

    • Simultaneous testing of thousands of OSNs

    • Identification of neurons with rare response patterns

    • Sequential screening with odorant cocktails followed by individual compounds

    • Potential recovery of responsive cells for molecular characterization

  • Deorphanization strategy: A systematic deorphanization protocol involves:

StageMethodologyExpected Outcome
Primary screeningBroad odorant panels tested against isolated OSNsIdentification of OSN populations responsive to specific chemical classes
Secondary validationTesting of individual compounds from active chemical classesConfirmation of specific ligand candidates
Dose-response analysisSerial dilutions of candidate ligandsDetermination of sensitivity thresholds and response dynamics
Structure-activity relationshipTesting of structural analogsIdentification of critical molecular features for receptor activation
Molecular confirmationHeterologous expression systems (e.g., Xenopus oocytes)Verification of direct ligand-receptor interactions

This comprehensive approach is necessary because OSNs expressing Or19b may display rare response patterns that would be missed by limited screening approaches .

How does Or19b expression correlate with behavioral phenotypes in Drosophila melanogaster?

The relationship between Or19b expression and behavioral phenotypes appears to be multifaceted:

  • Mating behavior modulation: Evidence suggests Or19b may be involved in mating behavior regulation. Reduced expression of Or19b in males (observed following Obp56h knockdown) correlates with enhanced mating behavior and reduced courtship latency . This suggests Or19b may function in pathways that normally inhibit or regulate mating timing.

  • Chemosensory pathway integration: Or19b expression changes occur alongside alterations in cuticular hydrocarbon (CHC) composition, particularly reduction in 5-tricosene (5-T), an inhibitory male pheromone . This suggests Or19b may function within an integrated chemosensory circuit that processes both external olfactory cues and feedback from the fly's own pheromone production.

  • Sex-specific effects: The relationship between Or19b and behavior appears to have sex-specific components, with expression changes documented specifically in males following Obp56h manipulation . This suggests potential sexually dimorphic functions.

  • Potential mapping approaches: To further elucidate behavioral correlations, researchers can employ:

    • Targeted Or19b manipulation in specific neuronal populations

    • Behavioral assays focusing on courtship timing, mate choice, and pheromone response

    • Integration with electrophysiological recordings to link receptor activation with behavioral outputs

Understanding these correlations requires controlling for genetic background effects, as natural variation in recombination and mutation rates between populations (such as between West African and European Drosophila melanogaster) may influence behavioral phenotypes .

What role does Or19b play in the broader olfactory receptor network of Drosophila melanogaster?

Or19b functions within a complex, interconnected olfactory receptor network characterized by:

  • Co-regulatory relationships: Or19b expression is coordinated with other chemoreception genes, suggesting shared regulatory mechanisms. Specifically, inhibition of Obp56h expression affects not only Or19b but also alters expression of lush, Obp83ef, and Obp19b . This indicates Or19b is embedded within a larger chemosensory regulatory network.

  • Functional diversification: The Drosophila olfactory system contains neurons with diverse response properties. While many OSNs are broadly tuned (responding to 3-4 odorants and representing 47% of responsive cells), there exist neurons with rare response patterns that respond selectively to specific odorants or odorant combinations . Or19b-expressing neurons may fall into this specialized category.

  • Network topology characteristics:

Network FeatureCharacteristics in DrosophilaPotential Implications for Or19b
Response breadth distribution25% of OSNs respond to all tested odorants; others show selective patternsPosition of Or19b-expressing neurons within this spectrum determines their function in odor discrimination
Connectivity patternsOSNs project to specific glomeruli in the antennal lobeOr19b-expressing neurons likely converge on dedicated glomeruli to process specific odorant information
Pathway integrationOlfactory information integrates with pheromone processingOr19b may function at the intersection of general olfaction and pheromone detection
Developmental regulationExpression patterns established during developmentDevelopmental timing of Or19b expression may influence its functional role
  • Computational implications: The organization of the olfactory receptor network suggests a coding strategy where broadly tuned receptors provide general detection capability while selectively tuned receptors (potentially including Or19b) enable discrimination of specific behaviorally relevant odorants .

What are the major technical challenges in studying Or19b function?

Researchers face several significant technical challenges when investigating Or19b function:

  • Neuron identification and isolation: Or19b-expressing neurons represent a small subpopulation of OSNs. Identifying and isolating these specific neurons requires sophisticated genetic labeling approaches and single-cell isolation techniques . Microfluidic trapping methods that maintain isolated OSNs during odorant exposure represent one potential solution .

  • Functional redundancy: The olfactory system exhibits redundancy, with multiple receptors potentially responding to similar odorants. Distinguishing Or19b-specific effects from those mediated by other receptors requires careful experimental controls and receptor-specific manipulations.

  • Temporal dynamics: Olfactory responses occur on millisecond timescales. Capturing these rapid dynamics requires high-speed calcium imaging or electrophysiological recording techniques with sufficient temporal resolution.

  • Natural ligand identification: The natural ligands for many odorant receptors remain unknown. For Or19b, systematic screening approaches using microfluidic devices and calcium imaging are necessary to identify physiologically relevant ligands .

  • Translation between in vitro and in vivo findings: Receptor responses observed in isolated neurons may differ from those in the intact animal due to network effects, neuromodulation, and experience-dependent plasticity. Bridging this gap requires complementary approaches combining ex vivo characterization with in vivo behavioral assessment.

How can evolutionary approaches enhance our understanding of Or19b function?

Evolutionary analyses provide valuable insights into Or19b function:

  • Comparative genomics strategy: Comparing Or19b sequences across Drosophila species reveals:

    • Conserved functional domains indicative of essential receptor functions

    • Variable regions potentially involved in species-specific ligand preferences

    • Signatures of selection suggesting evolutionary pressures on Or19b function

  • Population genetic approaches: Analysis of variation within species can identify:

    • Polymorphisms associated with functional differences

    • Signatures of recent selection

    • Geographic patterns of variation related to environmental adaptation

  • Functional divergence assessment: Experimental testing of Or19b orthologs from different species can reveal:

    • Shifts in ligand specificity across evolutionary time

    • Correlation between molecular evolution and ecological specialization

    • Mechanisms of receptor tuning

  • Relevance to recombination and mutation: Different Drosophila populations (e.g., West African vs. European) show variation in mutation and recombination rates . These differences may influence the evolutionary trajectory of Or19b and its functional properties. Systematic investigation of these variations provides context for interpreting Or19b function across populations.

  • Evolutionary-developmental perspective: Examining the developmental regulation of Or19b across species can reveal:

    • Conservation or divergence in expression patterns

    • Changes in regulatory mechanisms

    • Correlation between expression changes and behavioral adaptations

What are promising directions for integrating Or19b research with broader neuroscience questions?

Or19b research can be integrated with broader neuroscience through several promising approaches:

  • Circuit-level analysis: Mapping the complete neural circuit from Or19b-expressing OSNs to central brain regions will reveal:

    • Patterns of convergence and divergence in olfactory information processing

    • Integration with other sensory modalities

    • Connections to behavioral output circuits

  • Neuromodulatory effects: Investigating how the function of Or19b-expressing neurons is modulated by internal state, including:

    • Effects of hunger, satiety, and reproductive state on receptor sensitivity

    • Neuromodulator influences on signal amplification or attenuation

    • Experience-dependent plasticity mechanisms

  • Computational modeling: Developing models that predict:

    • How Or19b contributes to odor coding in combination with other receptors

    • Information processing strategies for distinguishing similar odorants

    • Population-level coding schemes across OSN types

  • Multimodal integration: Examining how Or19b-mediated olfactory input integrates with:

    • Gustatory information for comprehensive chemosensation

    • Visual and auditory cues during complex behaviors like courtship

    • Internal state information for context-appropriate responses

  • Translational implications: Exploring how insights from Or19b research might inform:

    • Development of novel insect repellents or attractants

    • Understanding evolutionary principles of sensory system organization

    • General principles of G-protein coupled receptor function applicable to human health

These integrative approaches position Or19b research within the broader context of systems neuroscience, potentially revealing general principles of sensory processing that extend beyond the specific receptor system.

What are the most effective CRISPR/Cas9 strategies for targeting Or19b in Drosophila melanogaster?

Optimal CRISPR/Cas9 strategies for Or19b manipulation include:

  • Guide RNA design considerations:

    • Target unique sequences within Or19b to minimize off-target effects

    • Select sites with high predicted editing efficiency

    • Avoid regions with known polymorphisms between strains

    • Design multiple gRNAs to increase editing success probability

  • Delivery methods:

    • Embryo microinjection of Cas9 protein and gRNA complexes offers highest efficiency

    • Germline-specific Cas9 expression (using nanos-Cas9) minimizes developmental effects

    • Heat-shock inducible systems provide temporal control of editing

  • Modification strategies:

Modification TypeResearch ApplicationDesign Considerations
Complete knockoutFunction elimination studiesDesign gRNAs targeting early exons; verify frameshift
Point mutationsStructure-function analysisProvide precise repair template with desired mutation
Fluorescent taggingExpression and localization studiesEnsure tag doesn't disrupt receptor function
Conditional allelesTemporal/spatial controlIncorporate LoxP or FRT sites for tissue-specific excision
  • Validation approaches:

    • PCR and sequencing to verify intended modifications

    • RT-PCR and RNA-seq to confirm expression changes

    • Functional assays (calcium imaging) to assess physiological consequences

    • Behavioral testing to evaluate organismal effects

  • Potential complications:

    • Recombination variation between Drosophila populations may affect homology-directed repair efficiency

    • The complex chromosomal landscape, with recombination rates varying 15-to-20-fold between adjacent regions , may influence editing outcomes

How can high-throughput methods be optimized for studying Or19b ligand interactions?

Optimizing high-throughput methods for Or19b ligand discovery requires:

  • Cell preparation optimization:

    • Develop reliable protocols for isolating Or19b-expressing OSNs

    • Implement microfluidic systems to trap and maintain isolated OSNs during experimental manipulations

    • Ensure consistent calcium indicator loading and cell viability

  • Screening strategy refinement:

    • Begin with diversified odorant panels representing major chemical classes

    • Implement hierarchical screening: first with chemical class mixtures, then individual compounds

    • Include controls for OSN health and general responsiveness

    • Design odorant panels based on ecological relevance to Drosophila

  • Data acquisition improvements:

    • Utilize automated microscopy with high-speed imaging capabilities

    • Implement microvalves for precise odorant delivery timing and concentration control

    • Develop real-time analysis pipelines to guide adaptive screening strategies

  • Analysis pipeline advancement:

    • Develop algorithms for automated detection of responsive cells

    • Implement machine learning approaches to classify response patterns

    • Establish standardized metrics for response amplitude, duration, and dynamics

    • Create visualization tools for complex response landscapes

  • Integration with molecular techniques:

    • Couple functional screening with single-cell RNA sequencing

    • Implement cell retrieval systems for post-functional analysis

    • Develop parallel screening of receptor variants to establish structure-function relationships

This comprehensive approach leverages the advantages of microfluidic platforms for detecting odorant-evoked calcium responses while addressing the challenges of rare response pattern identification that may characterize Or19b-expressing neurons.

What approaches can resolve contradictory data regarding Or19b function?

Resolving contradictory data regarding Or19b function requires methodical approaches:

  • Standardization of experimental conditions:

    • Establish consistent protocols for fly husbandry, age, and physiological state

    • Control for genetic background effects through proper backcrossing

    • Standardize environmental conditions during behavioral assays

    • Document detailed methodologies to enable exact replication

  • Comprehensive phenotyping:

    • Employ multiple complementary assays to characterize phenotypes

    • Collect quantitative data rather than binary outcomes

    • Include temporal dynamics in phenotypic analysis

    • Test across different environmental contexts and internal states

  • Genetic dissection strategies:

StrategyImplementationOutcome Assessment
Allelic seriesTest multiple alleles affecting Or19b functionDetermine if phenotypes correlate with allele strength
Rescue experimentsRe-express Or19b in knockout backgroundConfirm phenotype is specifically due to Or19b loss
Tissue-specific manipulationTarget Or19b in defined neural populationsMap the anatomical basis of phenotypic effects
Temporal controlUse conditional expression/suppressionDetermine critical periods for Or19b function
  • Integration of multiple data types:

    • Combine behavioral, physiological, and molecular measures

    • Correlate receptor activation with neural activity and behavior

    • Use computational models to predict emergent properties

  • Systematic meta-analysis:

    • Compile results across studies with standardized effect size measures

    • Identify moderator variables that explain contradictory outcomes

    • Perform power analyses to guide future experimental design

  • Consideration of population differences:

    • Test for variation between geographic populations of Drosophila

    • Account for differences in recombination rates between populations

    • Examine potential interaction with genetic background

This integrated approach acknowledges that contradictions often arise from legitimate biological complexity rather than technical errors, and seeks to resolve them through systematic investigation of conditional factors affecting Or19b function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.