Recombinant Drosophila melanogaster Putative odorant receptor 1a (Or1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please specify them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
Or1a; CG17885; Odorant receptor 1a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or1a
Target Protein Sequence
MSKLIEVFLGNLWTQRFTFARMGLDLQPDKKGNVLRSPLLYCIMCLTTSFELCTVCAFMV QNRNQIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQ NQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVY AMDCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSDFGLS GIFVEHARLLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGFFSLV VTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPKHRKLFLFPIERAQRETVLGAYF FELGRPLLVWIFRTAGSFTTLMNALYAKYETH
Uniprot No.

Target Background

Function
This odorant receptor mediates acceptance or avoidance behavior in response to various substrates. The odorant receptor repertoire encompasses a broad collection of odor stimuli, varying in identity, intensity, and duration. It may form a complex with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling, as well as calcium permeability. This receptor is involved in behavioral responses to butanal, heptanal, and 2-heptanone.
Gene References Into Functions
  1. Research indicates that animals lacking OR1a-expressing neurons exhibit reduced chemotaxis to only one out of 20 odors tested. PMID: 18683639
Database Links
Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the maxillary palp.

Q&A

What is the functional role of Odorant Receptor 1a (Or1a) in Drosophila melanogaster?

Odorant Receptor 1a (Or1a) is part of the olfactory system in Drosophila melanogaster that enables the fly to detect specific environmental chemicals. Similar to other odorant receptors, Or1a is likely expressed in specific olfactory receptor neurons (ORNs) and confers odor responsiveness to these neurons. As demonstrated with Or43b, individual receptors typically respond to a specific set of odorants, contributing to the fly's ability to discriminate between different chemical cues in its environment. The specificity of an odorant receptor is critical for appropriate behavioral responses to environmental stimuli .

How are odorant receptor genes selected for expression in specific olfactory neurons?

The selection of which odorant receptor gene to express in a specific olfactory neuron involves both positive and negative regulatory elements. Research has shown that receptor gene choice depends on a combinatorial code of transcription factors that generate the receptor-to-neuron map. This process is not random but is tightly controlled to ensure that specific receptors are expressed in the appropriate olfactory organ. Additionally, there is evidence that choices made by neighboring ORNs within a sensillum are coordinated through the asymmetric segregation of regulatory factors from a common progenitor, rather than through negative feedback regulation .

What genetic engineering approaches are most effective for studying Or1a function?

Multiple genetic engineering approaches can be employed to study Or1a function in Drosophila:

  • CRISPR/Cas9 genome editing: Provides precise modification of the Or1a locus.

  • Recombinase-mediated cassette exchange (RMCE): Allows for sequential introduction of different transgenic constructs at the Or1a locus.

  • Phage recombinase systems: The Bxb1 recombinase system offers highly efficient activity for targeted genomic modifications.

The Bxb1 phage recombinase has been successfully adapted for Drosophila genome engineering and can be used alone or in conjunction with other recombinases like Flp, Cre, and FC31 for creating platforms for cassette exchange of targeted loci. This diversity of tools allows researchers to design sophisticated experimental approaches to study Or1a function in various genetic backgrounds and developmental contexts .

How do natural genetic variations affect odorant receptor function and expression?

Natural genetic variation can significantly impact odorant receptor function and expression. Studies of recombination rates in D. melanogaster have revealed ~2-fold variation among inbred lines of the Drosophila Genetic Reference Panel (DGRP). Although not specifically addressing Or1a, this research suggests substantial genetic diversity affecting genomic processes. The natural variation in receptor expression patterns could influence olfactory perception and subsequent behaviors across Drosophila populations .

Five genes have been identified that likely contribute to natural variation in recombination rate in D. melanogaster, and these genes lie outside the canonical meiotic recombination pathway. Such findings highlight the complexity of genetic regulation and suggest that similar mechanisms might influence odorant receptor expression and function .

What are the challenges in differentiating the functions of closely related odorant receptors in the Drosophila genome?

Differentiating the functions of closely related odorant receptors presents several challenges:

  • Functional redundancy: As observed with Or43b, the Drosophila olfactory system exhibits functional redundancy, where loss of one receptor may have minimal effect on olfactory behavior due to compensation by other receptors.

  • Co-expression patterns: Some odorant receptors are co-expressed due to alternative splicing or through dicistronic mRNAs, complicating the isolation of individual receptor functions.

  • Cross-reactivity: Different odorant receptors may respond to overlapping sets of odorants with varying sensitivities, making it difficult to associate specific behavioral responses with individual receptors.

A comprehensive approach combining genetic, molecular, electrophysiological, and behavioral techniques is necessary to fully differentiate the specific contributions of individual odorant receptors within the complex olfactory system .

What are the recommended approaches for generating recombinant Or1a constructs?

Based on current methodologies in Drosophila research, several approaches can be used for generating recombinant Or1a constructs:

ApproachMethodologyAdvantagesConsiderations
CRISPR/Cas9Direct editing of the Or1a locusPrecise modification; maintains native regulationRequires careful sgRNA design; potential off-target effects
RMCE with Bxb1Introduction of recombinase recognition sites flanking Or1aAllows sequential modification of the same locusRequires initial insertion of acceptor cassette
Gateway cloningTransfer of Or1a between vectors using att sitesFlexible; compatible with various expression systemsMultiple cloning steps required
Gibson AssemblySeamless assembly of Or1a with regulatory elementsNo restriction site limitations; single-step reactionRequires careful primer design

The choice of method should be based on experimental goals, such as whether native expression patterns need to be maintained or if overexpression in specific tissues is desired. For studying Or1a in its normal cellular context, CRISPR/Cas9 or RMCE approaches would be most appropriate .

How can researchers effectively analyze changes in olfactory behavior resulting from Or1a manipulation?

Effective analysis of olfactory behavior changes resulting from Or1a manipulation requires a multi-tiered approach:

  • Electrophysiological recordings: Measure direct neuronal responses to odorants in control versus Or1a-manipulated flies.

  • T-maze assays: Quantify attractive or aversive responses to specific odorants.

  • Flight simulator experiments: Assess olfactory navigation behaviors in tethered flies.

  • Free walking assays: Track movement patterns in response to odor gradients.

  • Activity monitoring: Measure long-term behavioral changes in response to constant odor exposure.

It is essential to include appropriate genetic controls and to test responses to a range of odorant concentrations, as receptor sensitivity can vary. Additionally, behavioral assays should be conducted under controlled environmental conditions (temperature, humidity, time of day) to minimize variability. Statistical analysis should account for potential genetic background effects and consider population-level variation in olfactory responses .

What techniques are available for visualizing Or1a expression patterns in the olfactory system?

Several techniques can be employed to visualize Or1a expression patterns:

  • Fluorescent reporter constructs: Generating Or1a-GAL4 or Or1a-QF driver lines to express fluorescent proteins in Or1a-positive neurons.

  • Immunohistochemistry: Using antibodies against Or1a protein or epitope-tagged versions.

  • RNA in situ hybridization: Detecting Or1a mRNA transcripts in tissue sections.

  • TRAP (Translating Ribosome Affinity Purification): Isolating actively translated mRNAs from Or1a-expressing cells.

  • Single-cell RNA sequencing: Identifying cells expressing Or1a and characterizing their transcriptional profiles.

These approaches can be combined with anatomical markers to precisely map Or1a expression patterns throughout development and in different physiological conditions. This multi-method validation is important as expression levels of odorant receptors can be relatively low and may vary across developmental stages .

How should researchers analyze RNA-seq data to identify regulatory elements affecting Or1a expression?

Analysis of RNA-seq data to identify regulatory elements affecting Or1a expression requires a systematic approach:

  • Differential expression analysis: Compare transcriptomes from wild-type and mutant flies to identify changes in Or1a expression levels.

  • Motif discovery: Analyze upstream and intronic regions of Or1a for potential transcription factor binding sites.

  • Chromatin accessibility profiling: Use ATAC-seq or DNase-seq to identify open chromatin regions near the Or1a locus.

  • Comparative genomics: Align regulatory regions of Or1a across different Drosophila species to identify conserved elements.

  • Correlation analysis: Identify transcription factors whose expression correlates with Or1a across tissues or developmental stages.

This comprehensive approach can reveal both positive and negative regulatory elements that control Or1a expression in specific olfactory receptor neurons. As observed with other odorant receptor genes, the selection of Or1a for expression likely depends on a combinatorial code of transcription factors .

What are the considerations for analyzing evolutionary conservation of Or1a across Drosophila species?

When analyzing evolutionary conservation of Or1a across Drosophila species, researchers should consider:

  • Sequence conservation: Compare coding sequences to identify conserved functional domains versus variable regions that might confer species-specific responses.

  • Expression pattern conservation: Determine whether Or1a is expressed in homologous neurons across species.

  • Functional conservation: Test whether Or1a from different species responds to the same odorants.

  • Regulatory element conservation: Examine conservation of promoter and enhancer regions that control Or1a expression.

  • Adaptive evolution signatures: Analyze the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify regions under positive selection.

Experimental evolution approaches, as described for other Drosophila traits, can also be applied to study how Or1a might adapt to different environmental conditions over time. This evolutionary perspective provides insights into the functional significance of specific receptor features and their contribution to ecological adaptation .

How can researchers reconcile contradictory findings about Or1a function in different experimental systems?

Resolving contradictory findings about Or1a function across different experimental systems requires careful consideration of several factors:

  • Genetic background effects: Different Drosophila strains may contain genetic modifiers that influence Or1a function. Using isogenic backgrounds and controlling for natural genetic variation is essential.

  • Expression level differences: Heterologous expression systems may produce different receptor levels compared to native expression, affecting sensitivity and specificity.

  • Post-translational modifications: Different systems may process the receptor protein differently, affecting function.

  • Experimental conditions: Temperature, pH, and the presence of cofactors can significantly impact receptor function.

  • Methodology differences: Electrophysiology, calcium imaging, and behavioral assays may yield different results due to varying sensitivity and the measurement of different aspects of receptor function.

To address these contradictions, researchers should implement standardized protocols, use multiple complementary approaches, and conduct experiments in the receptor's native cellular environment whenever possible. As demonstrated with other odorant receptors, a single receptor confers specific odor responsiveness to olfactory neurons, but the behavioral output depends on the integration of signals from multiple receptor types .

What emerging technologies will advance our understanding of Or1a regulation and function?

Several emerging technologies hold promise for advancing our understanding of Or1a:

  • Single-cell multi-omics: Integrating transcriptomics, epigenomics, and proteomics at the single-cell level to comprehensively characterize Or1a-expressing neurons.

  • Optogenetics and chemogenetics: Allowing precise temporal control of Or1a-expressing neurons to dissect their contribution to circuit function.

  • Advanced microscopy techniques: Super-resolution and light-sheet microscopy for detailed visualization of Or1a localization and trafficking.

  • Cryo-EM: Potential structural determination of Or1a protein, providing insights into odorant binding mechanisms.

  • CRISPR screening: Systematic identification of genes affecting Or1a expression and function through genome-wide CRISPR screens.

These technologies, combined with the genetic toolbox available in Drosophila, will enable more detailed understanding of how Or1a contributes to olfactory coding and subsequent behaviors .

How might understanding Or1a function contribute to broader neuroscience research?

Understanding Or1a function can contribute to broader neuroscience in several ways:

  • Sensory coding principles: Insights into how specific receptor-ligand interactions are translated into neural codes.

  • Circuit development: Understanding how receptor expression shapes the wiring of olfactory circuits during development.

  • Evolutionary neurobiology: Revealing how sensory systems adapt to different ecological niches.

  • Translational research: Potential applications in developing novel insect repellents or attractants based on Or1a ligands.

  • Fundamental receptor biology: Contributing to our understanding of G-protein coupled receptor function and regulation.

The Drosophila olfactory system, with its genetic tractability and relatively simple organization compared to vertebrates, provides an excellent model for studying principles of sensory processing that may be conserved across species. As demonstrated with other odorant receptors, understanding the mechanisms of odor detection at the molecular level can provide insights into how sensory information is processed and translated into appropriate behavioral responses .

What are the potential applications of Or1a research in agricultural pest management?

Research on Or1a and other odorant receptors has potential applications in agricultural pest management:

  • Targeted insect attractants: Developing compounds that specifically activate Or1a to create highly effective baits.

  • Novel repellents: Identifying compounds that disrupt Or1a function to deter pest Drosophila species from crops.

  • Genetic control strategies: Engineering flies with modified Or1a function to disrupt mating or host-finding behaviors.

  • Monitoring tools: Creating biosensors based on Or1a to detect specific plant volatiles associated with fruit ripening or damage.

  • Cross-species applications: Applying insights from Drosophila Or1a to understand related receptors in agricultural pest insects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.