Recombinant Drosophila melanogaster Putative odorant receptor 59b (Or59b)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Olfaction and DEET Sensitivity

Or59b plays dual roles in odorant detection and insect repellent (DEET) modulation:

  • Odorant Sensing: Mediates responses to volatile compounds such as 1-octen-3-ol, which acts as both an inhibitor and activator depending on concentration .

  • DEET Interaction: Acts as a DEET-sensitive receptor, where DEET scrambles odorant signaling by modulating the Or59b-Orco complex . A natural polymorphism (Val91Ala) in Brazilian D. melanogaster strains abolishes DEET sensitivity and alters odorant response profiles .

Key Research Findings:

  • Electrophysiological Behavior:

    • Wild-type Or59b is inhibited by 10⁻⁴–10⁻² dilutions of 1-octen-3-ol, while the Val91Ala mutant shows activation at these concentrations .

    • DEET suppresses inhibition by 1-octen-3-ol in wild-type Or59b but has no effect on the Val91Ala variant .

  • Genetic Polymorphisms: Seven missense mutations identified in global D. melanogaster strains, with Val91Ala being critical for DEET resistance .

Applications in Research

Recombinant Or59b is widely used to study insect olfaction, repellent efficacy, and receptor-ligand interactions:

  • Olfactory Circuit Studies: Used in D. melanogaster "empty neuron" systems to dissect odorant receptor function .

  • DEET Mechanism: Provides insights into how DEET disrupts insect olfactory coding, aiding in the development of next-generation repellents .

  • Oogenesis Regulation: Indirectly linked to olfactory input pathways affecting D. melanogaster reproductive physiology .

Gene Regulation and Interaction Network

  • Epigenetic Regulation: Expression is modulated by histone modifications (H3K9me3) and chromatin remodelers like Kdm4B and dLsd1 .

  • Protein Partners:

    • Forms functional complexes with Orco for calcium-permeable ion channel activity .

    • Interacts with odorants (e.g., 1-octen-3-ol) and repellents (DEET) .

Table 3: Functional Partners of Or59b

Partner ProteinRole in OlfactionInteraction Score
Or85bMediates responses to esters and ketones0.863
Or56aDetects geosmin (microbial odorant)0.813
OrcoEssential co-receptor for ion channel functionN/A

Challenges and Future Directions

  • Structural Resolution: The absence of a crystallized Or59b structure limits mechanistic studies of ligand binding .

  • Species-Specific Variation: Natural polymorphisms (e.g., Val91Ala) highlight evolutionary adaptations to environmental repellents .

  • Broader Implications: Co-expression with Ir25a in Anopheles coluzzii suggests conserved roles in insect olfactory systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Or59b; CG3569; Odorant receptor 59b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or59b
Target Protein Sequence
MAVFKLIKPAPLTEKVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFY LPVGFIISYVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDK RLANDSDRERIHNMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDG MGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEAD NYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVAS LLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPII FIAGGIFPISMNSNITVAKFAFSIITIVRQMNLAEQFQ
Uniprot No.

Target Background

Function
Or59b is an odorant receptor mediating acceptance or avoidance behaviors based on substrate interaction. The odorant receptor repertoire detects a wide range of odor stimuli varying in identity, intensity, and duration. Or59b forms a complex with Orco, creating odorant-sensing units that enable sensitive, prolonged odorant signaling and calcium permeability. It also plays a role in the response to N,N-Diethyl-meta-toluamide (DEET), a widely used insect repellent.
Database Links

KEGG: dme:Dmel_CG3569

STRING: 7227.FBpp0071930

UniGene: Dm.23265

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is Drosophila melanogaster Odorant Receptor 59b (Or59b)?

Or59b is a putative odorant receptor protein expressed in specific olfactory sensory neurons (OSNs) of Drosophila melanogaster. It functions as a chemosensor that detects volatile odorant molecules in the environment and converts this chemical information into electrical signals that can be processed by the fly's nervous system. Or59b belongs to the broader family of insect odorant receptors that play crucial roles in chemosensation. The receptor is particularly well-studied as a model for understanding the molecular mechanisms of olfaction and has been characterized through both functional and structural approaches .

How does Or59b contribute to olfactory behavior in Drosophila?

Or59b contributes to olfactory behavior by enabling flies to detect and discriminate specific environmental odorants. The activation of Or59b triggers a signaling cascade that ultimately results in behavioral responses appropriate to the detected odorants. Studies have demonstrated that Or59b responds to various odorants with distinct temporal patterns, encoding information about both the identity and concentration of the odorant . For example, when stimulated with acetone, Or59b-expressing neurons show characteristic "chair-shaped" response patterns that have been precisely modeled and experimentally validated . These responses form part of the fly's olfactory code, enabling complex behaviors such as food searching, predator avoidance, and mate selection.

What odorants are known to activate Or59b?

Or59b responds to a variety of odorants, with particularly robust responses to ketones and related compounds. Experimental research has characterized its response to several key odorants:

OdorantBinding Rate (ppm·s)^-1Dissociation Rate (s^-1)Notes
Acetone2.17 × 10^-22.94Well-characterized temporal response patterns
2-Butanone2.18 × 10^-12.94Higher binding affinity than acetone
Methyl butyrateVariesVariesResponse characterized in electrophysiological studies
ButyraldehydeVariesVariesStudied in comparison with other aldehydes

The receptor shows differential sensitivity to these compounds, with response magnitudes dependent on both the chemical structure and concentration of the odorant .

How do natural polymorphisms in Or59b affect odorant sensitivity?

Natural polymorphisms in the Or59b gene can significantly alter the receptor's sensitivity to specific odorants. Research has identified single nucleotide polymorphisms (SNPs) that modify how the receptor responds to various compounds. A notable example is a single amino acid polymorphism in the second transmembrane domain of Or59b identified in a Drosophila melanogaster strain from Brazil . This polymorphism renders the receptor insensitive to inhibition by odor ligands and modulation by DEET (N,N-diethyl-meta-toluamide) .

Sequencing studies across multiple Drosophila strains have revealed seven missense polymorphisms and 36 silent polymorphisms in the Or59b gene . These natural variations provide valuable insights into structure-function relationships of the receptor and demonstrate how evolutionary pressures shape olfactory systems across different populations.

What is the relationship between Or59b and DEET sensitivity?

Research has revealed an intriguing relationship between Or59b and sensitivity to DEET, one of the most effective insect repellents. Studies have shown that DEET can modulate the function of Or59b in a manner that depends on the specific odorant ligand and its concentration . This modulation contributes to DEET's repellent effect by "confusing" the insect's olfactory code, disrupting normal odor perception.

The single amino acid polymorphism identified in the second transmembrane domain of Or59b in a Brazilian Drosophila strain renders this receptor insensitive to both inhibition by certain odor ligands and modulation by DEET . This finding provides compelling evidence for the hypothesis that DEET acts as a molecular "confusant" that scrambles the insect odor code, explaining its broad-spectrum efficacy against multiple insect species . This relationship between Or59b and DEET sensitivity illustrates how natural genetic variation can influence repellent effectiveness and offers insights into potential mechanisms for repellent resistance in insect populations.

How does the thermodynamic model explain Or59b gene regulation?

A thermodynamic model has been developed to explain how the main regulatory cluster of the Or59b gene drives its transcription in Drosophila . This model uses a statistical thermodynamic approach to represent the cluster-driven expression of Or59b as the equilibrium probability of RNA polymerase (RNAp) being bound to the promoter region .

The model accounts for the complexity of eukaryotic promoters, which contain multiple cis-regulatory sequences for different transcription factors (TFs). It computes the RNAp equilibrium probability in terms of:

  • The occupancy probabilities of individual TFs in the cluster binding to their corresponding sites

  • The interaction rules among TFs and RNAp

  • The effects of epigenetic modifications on binding affinities

This thermodynamic approach successfully reproduces changes in RNAp binding probability induced by various mutations of specific binding sites and epigenetic modifications . By incorporating the binding patterns of TFs to regulatory sites and their interactions with each other and with RNAp, the model addresses the combinatorial problems inherent in understanding complex gene regulation under varying epigenetic conditions.

What are the best methods for studying Or59b receptor response to odorants?

Several complementary methods have proven effective for studying Or59b receptor responses to odorants:

  • Electrophysiological recordings: Single-sensillum recordings from Or59b-expressing olfactory sensory neurons (OSNs) provide direct measurements of receptor activity in response to odorant stimulation . This technique allows researchers to measure action potential firing rates and patterns in real-time, offering high temporal resolution of receptor responses.

  • Functional imaging: Calcium imaging or voltage imaging of Or59b-expressing neurons can visualize receptor activation across populations of cells, providing spatial information about receptor distribution and response.

  • Computational modeling: Mathematical models, such as the OTP/BSG cascade model (Odorant Transduction Process/Biophysical Spike Generator), can simulate Or59b responses to various odorant waveforms . These models help predict receptor behavior under different stimulation conditions and provide a theoretical framework for understanding the underlying mechanisms.

  • Molecular genetics: Techniques such as CRISPR-Cas9 gene editing allow researchers to introduce specific mutations into the Or59b gene to study how sequence variations affect receptor function .

  • Behavioral assays: Measuring behavioral responses of flies with modified Or59b receptors to different odorants provides insights into the functional consequences of receptor variations at the whole-organism level.

For optimal results, researchers typically combine multiple methods to provide complementary perspectives on Or59b function.

How can we create and validate models of Or59b olfactory sensory neuron responses?

Creating and validating models of Or59b olfactory sensory neuron (OSN) responses involves several key steps:

  • Model development: The comprehensive model of fruit fly OSNs consists of an odorant transduction process (OTP) and a biophysical spike generator (BSG) . The OTP component captures the binding kinetics between odorants and receptors, while the BSG translates receptor activation into action potentials.

  • Parameter optimization: Critical parameters must be optimized using experimental data . For the (acetone, Or59b) pair, the following parameters were determined:

    • Binding rate: 2.17 × 10^-2 (ppm·s)^-1

    • Dissociation rate: 2.94 s^-1

  • Model validation with diverse stimuli: The model should be tested against various stimulus waveforms:

Stimulus TypeMean Squared ErrorResponse Characteristics
Step13.84"Chair-shaped" response with initial peak followed by adaptation
Ramp14.92Rapid increase followed by plateau
Parabola13.71Ramp-like response corresponding to gradient
White noise8.94Complex temporal pattern with smoothed features
  • Critical components analysis: Research has shown that the peri-receptor process filter is critical for processing white noise waveforms but less important for static waveforms . Without this filter, the model cannot accurately match Or59b OSN responses to acetone waveforms.

  • Cross-validation: The model should predict responses to novel stimuli not used during parameter optimization, with predictions verified through additional experiments.

What techniques are used to identify polymorphisms in Or59b?

Several molecular and genetic techniques are employed to identify polymorphisms in the Or59b gene:

  • DNA sequencing: Traditional Sanger sequencing or next-generation sequencing methods are used to determine the complete nucleotide sequence of the Or59b coding region across different strains or populations of Drosophila melanogaster .

  • Population genetics screening: Sequencing the Or59b gene in numerous individuals from diverse geographic locations helps identify natural variations and their frequencies in different populations. For example, sequencing Or59b in multiple Drosophila strains revealed seven missense polymorphisms and 36 silent polymorphisms .

  • Functional characterization: Once polymorphisms are identified, their functional effects can be assessed using electrophysiological recordings from neurons expressing the variant receptors. These experiments reveal how specific amino acid changes alter receptor sensitivity to odorants and compounds like DEET .

  • Structure-function analysis: Comparing the locations of polymorphisms with the predicted structural domains of the Or59b protein can provide insights into how specific variations might affect receptor function. For instance, the polymorphism identified in the second transmembrane domain of Or59b significantly alters its response properties .

  • Genome-wide association studies (GWAS): By correlating phenotypic variation in olfactory responses with genetic variation across the genome, researchers can identify polymorphisms in Or59b and other genes that contribute to differences in olfactory behavior.

How can contradictory results in Or59b response patterns be reconciled?

Contradictory results in Or59b response patterns can arise from various sources and require careful analysis to reconcile:

What factors should be considered when comparing Or59b responses across different odorants?

When comparing Or59b responses across different odorants, several key factors should be considered:

  • Molecular structure similarity: Structurally similar odorants often elicit related response patterns. For example, benzaldehyde and acetophenone differ only in a methyl group that transforms the aldehyde group on the benzene ring into an acetyl moiety, yet they can activate overlapping but distinct sets of odorant-binding proteins .

  • Binding kinetics: Different odorants have distinct binding rates and dissociation rates with Or59b. These kinetic parameters significantly influence response dynamics.

  • Concentration scaling: Odorants with different binding rates may elicit similar responses when their concentrations are appropriately scaled. Research has shown that acetone at 100 ppm and 2-butanone at 10 ppm elicit almost identical responses from Or59b OSNs because the difference in binding rate is perfectly counterbalanced by the scaling factors .

  • Response comparison framework: When comparing responses to different odorants, researchers should consider:

Comparison AspectMethodologySignificance
Peak amplitudeMaximum firing rate or calcium signalIndicates maximum sensitivity
Response latencyTime to response onsetReflects binding kinetics
Adaptation rateDecay time constantReveals receptor desensitization properties
Dose-response curveResponse magnitude across concentrationsCharacterizes dynamic range and sensitivity
Temporal patternFull PSTH analysisCaptures complex encoding properties
  • Genetic background: Natural polymorphisms in Or59b can alter its responsiveness to specific odorants . When comparing responses across odorants, it's essential to ensure that the genetic background is consistent or to account for known polymorphisms.

How do computational models of Or59b compare with experimental data?

Computational models of Or59b have shown impressive agreement with experimental data when properly parameterized and validated:

  • OTP/BSG cascade model performance: The OTP/BSG cascade model of Or59b responses to acetone closely matches electrophysiological recordings across various stimulus waveforms . For step, ramp, and parabola stimuli, the model achieves mean squared errors of 13.84, 14.92, and 13.71, respectively . For white noise stimuli, the error is even lower at 8.94 , indicating excellent agreement between model predictions and experimental observations.

  • Capturing complex temporal dynamics: The OTP/BSG model successfully captures the complex temporal dynamics of Or59b responses, including the characteristic "chair-shaped" response to step stimuli, the rapid increase followed by plateau for ramp stimuli, and the ramp-like response to parabola stimuli .

  • Prediction of concentration scaling effects: The model correctly predicts that different odorants (acetone and 2-butanone) at appropriately scaled concentrations (100 ppm and 10 ppm, respectively) elicit nearly identical responses from Or59b OSNs . This demonstrates the model's ability to account for the interaction between binding kinetics and concentration.

  • Thermodynamic model of gene regulation: The thermodynamic model of Or59b gene regulation successfully reproduces changes in RNA polymerase binding probability induced by various mutations of specific sites and epigenetic modifications . This model has been validated using experimental data on Or59b expression.

  • Limitations and refinements: Despite their success, computational models continue to be refined to better capture all aspects of Or59b function. The peri-receptor process filter in the OTP model, for example, was found to be critical for processing white noise waveforms but less important for static waveforms . Such refinements highlight the ongoing dialogue between computational modeling and experimental research.

How do Or59b polymorphisms influence population-level adaptation?

The discovery of multiple polymorphisms in Or59b across different Drosophila populations raises important questions about their adaptive significance. Research has shown that a single amino acid polymorphism in the second transmembrane domain of Or59b can dramatically alter sensitivity to both odorants and DEET . This finding suggests that Or59b polymorphisms might contribute to local adaptation of fly populations to different chemical environments and host plants.

Future research directions should include systematic studies of Or59b polymorphism frequencies across populations with different ecological niches, correlating these genetic variations with behavioral and electrophysiological phenotypes. Such studies would provide insights into how natural selection acts on olfactory receptor genes and how this contributes to speciation and adaptation.

What is the three-dimensional structure of Or59b and how does it determine ligand specificity?

While significant progress has been made in understanding Or59b function, its three-dimensional structure remains to be fully elucidated. Recent advances in structural biology techniques, including cryo-electron microscopy and computational modeling, offer promising approaches for determining the structure of this receptor. A detailed structural model would provide invaluable insights into the molecular mechanisms of odorant binding, receptor activation, and the effects of polymorphisms on receptor function.

Research should focus on identifying the specific amino acid residues that form the odorant binding pocket, the structural changes that occur during receptor activation, and the molecular basis for the differential responses to various odorants. Such structural insights would also facilitate rational design of compounds that modulate Or59b function, potentially leading to new approaches for controlling insect behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.