Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform A (Or69a)

Shipped with Ice Packs
In Stock

Description

Introduction to Or69aA

Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform A (Or69aA) is a splice variant of the Or69a gene, encoding a chemosensory receptor critical for detecting pheromones and food-related odorants in Drosophila melanogaster. This isoform arises from alternative splicing of the Or69a gene, which also produces Or69aB, a structurally distinct but co-expressed receptor . Or69aA belongs to the odorant receptor (OR) family, a group of 60+ proteins responsible for detecting volatile molecules in flies .

Gene Organization and Splicing

  • The Or69a gene is located on chromosome 3R in D. melanogaster and encodes two proteins via alternative splicing:

    • Or69aA: Expressed in ab9A sensilla (antennal olfactory sensory neurons).

    • Or69aB: Co-expressed with Or69aA in the same neurons .

  • Both isoforms share a conserved N-terminal domain but diverge in their transmembrane regions, conferring distinct ligand affinities .

Phylogenetic Relationships

  • Or69aA is part of the D. melanogaster OR family, which diverged from gustatory receptors (GRs) early in insect evolution .

  • Within the OR family, Or69aA shows low sequence similarity (<20%) to other ORs, reflecting its unique functional specialization .

Ligand Binding and Response Profiles

Or69aA exhibits broad ligand specificity, responding to diverse odorants, including:

LigandResponse IntensitySource
Ethyl 3-hydroxyhexanoateStrong
Alpha-terpineolStrong
3-OctanolModerate
LinaloolModerate
(R)-CarvoneWeak
  • Note: Or69aA’s responses are weaker compared to Or69aB, which shows higher sensitivity to pheromones like (Z)-4-undecenal (Z4-11Al) .

Co-Expression with Or69aB

  • Or69aA and Or69aB are co-expressed in ab9A neurons, enabling the same sensory neuron to detect both pheromones (e.g., Z4-11Al) and food-related terpenoids (e.g., linalool) .

  • Heterologous expression studies in ab3A neurons reveal that:

    • Or69aA alone: Responds to esters and alcohols.

    • Or69aB alone: Responds to carvones and Z4-11Al.

    • Or69aA + Or69aB: Recreates the native ab9A response profile .

Species Comparisons

SpeciesOr69aA Response to Z4-11AlResponse to (R)-CarvoneSource
D. melanogasterWeakStrong
D. simulansVery weakStrong
  • Mechanism: Or69aB in D. melanogaster specifically detects Z4-11Al, while D. simulans lacks this tuning, contributing to reproductive isolation .

Sex-Specific Modulation

  • Males: Or69aA expression is downregulated by male-derived pheromones (e.g., cis-vaccenyl acetate), reducing responsiveness to conspecific males .

  • Females: Exposure to male scents increases Or69a transcription, enhancing sensitivity to Z4-11Al and food odors .

Pheromone and Food Odor Integration

  • Pheromone Detection: Or69aB (co-expressed with Or69aA) detects Z4-11Al, a female-released long-range pheromone critical for mate attraction .

  • Food Attraction: Or69aA responds to linalool and terpineol, found in yeast and citrus, guiding oviposition and feeding .

  • Antagonistic Interactions: Z4-11Al inhibits attraction to food odors in D. simulans, preventing interspecies mating .

Reproductive Isolation

  • Or69a Tuning: Differences in Or69aA/B ligand affinities between D. melanogaster and D. simulans act as a barrier to hybridization .

  • Evolutionary Advantage: The dual role of Or69a in pheromone and food detection may drive ecological specialization and speciation .

Research Challenges and Future Directions

  1. Structural Determinants: High-resolution crystallography to map ligand-binding pockets in Or69aA vs. Or69aB.

  2. Synaptic Integration: Mapping Or69aA-expressing neurons’ projections in the antennal lobe and lateral horn.

  3. Population Genetics: Assessing Or69a polymorphisms linked to behavioral variation in natural populations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or69a; Or69b; CG32116; Putative odorant receptor 69a, isoform A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or69a
Target Protein Sequence
MQLHDHMKYIDLGCKMACIPRYQWKGRPTERQFYASEQRIVFLLGTICQIFQITGVLIYW YCNGRLATETGTFVAQLSEMCSSFCLTFVGFCNVYAISTNRNQIETLLEELHQIYPRYRK NHYRCQHYFDMAMTIMRIEFLFYMILYVYYNSAPLWVLLWEHLHEEYDLSFKTQTNTWFP WKVHGSALGFGMAVLSITVGSFVGVGFSIVTQNLICLLTFQLKLHYDGISSQLVSLDCRR PGAHKELSILIAHHSRILQLGDQVNDIMNFVFGSSLVGATIAICMSSVSIMLLDLASAFK YASGLVAFVLYNFVICYMGTEVTLASGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPY MWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK
Uniprot No.

Target Background

Function
This odorant receptor mediates acceptance or avoidance behavior in response to its substrates. The odorant receptor repertoire encompasses a wide range of odor stimuli that vary in their identity, intensity, and duration. Or69a may form a complex with Orco to create odorant-sensing units, facilitating sensitive and prolonged odorant signaling and calcium permeability.
Database Links

STRING: 7227.FBpp0089412

UniGene: Dm.26498

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is the ligand binding profile of Drosophila melanogaster Or69a?

Or69a demonstrates a broad response spectrum with several notable ligands. The receptor shows strongest responses to 3-hydroxyhexanoate, alpha-terpineol, 3-octanol, and linalool . This broad response pattern suggests Or69a may play a role in detecting multiple odorant classes rather than being narrowly tuned to specific molecular structures. When designing experiments involving Or69a, researchers should consider this diverse ligand profile and potentially include multiple representative compounds from its activation spectrum for comprehensive assessments.

How is Or69a functionally characterized in Drosophila melanogaster?

Functional characterization of Or69a typically involves calcium imaging techniques measuring neuronal responses to various odorants. As demonstrated in comprehensive studies of Drosophila olfactory receptors, calcium imaging allows for quantification of response intensities across approximately 100 different odorants, adding over 500 new odorant responses to the characterization database . For proper functional characterization, researchers should employ both in vivo approaches (examining responses in intact sensory neurons) and heterologous expression systems (expressing Or69a in cell lines like Xenopus oocytes or HEK293 cells) to fully understand receptor properties.

Where is Or69a expressed in the Drosophila olfactory system?

Or69a is expressed in specific olfactory sensory neurons (OSNs) in the antenna, the primary olfactory organ of Drosophila. These neurons project to dedicated glomeruli in the antennal lobe for primary olfactory processing. While the precise glomerular target is not specified in the provided search results, mapping studies using GAL4 drivers can pinpoint the exact glomerular projection, which is critical for understanding its role in the olfactory circuit.

What are the most effective methods for measuring Or69a activation in research settings?

Several complementary techniques provide comprehensive assessment of Or69a activation:

  • Calcium Imaging: This method measures changes in intracellular calcium concentration in response to ligand binding. Similar to studies of other olfactory receptors like Or10a, Or42b, Or47b, and Or56a, calcium imaging can detect both excitatory and inhibitory responses . Researchers should use genetically-encoded calcium indicators like GCaMP for optimal results.

  • Electrophysiology: Single sensillum recordings (SSR) enable direct measurement of action potentials generated when Or69a-expressing neurons respond to odorants. This technique offers high temporal resolution but requires specialized equipment and expertise.

  • Heterologous Expression Systems: Expressing Or69a in cell lines allows for controlled assessment of receptor properties. This approach is valuable for pharmacological characterization but may not fully recapitulate in vivo dynamics.

How can I genetically manipulate Or69a expression for experimental purposes?

Genetic manipulation of Or69a can be achieved through several approaches:

  • RNA Interference (RNAi): Similar to the Obp69a-RNAi strategy described in the literature, researchers can downregulate Or69a expression using UAS-Or69a-RNAi constructs expressed under appropriate GAL4 drivers . This approach allows for tissue-specific knockdown.

  • CRISPR/Cas9 Mutagenesis: For complete loss-of-function studies, CRISPR/Cas9 can generate precise deletions or modifications in the Or69a gene. This technique produces stable mutant lines for comprehensive phenotypic analysis.

  • Overexpression Studies: Transgenic lines carrying UAS-Or69a constructs paired with appropriate GAL4 drivers enable controlled overexpression to assess gain-of-function effects.

Each method presents distinct advantages for different research questions, from partial knockdown to complete deletion to ectopic expression.

What considerations are important when designing behavioral assays to study Or69a function?

When designing behavioral assays to investigate Or69a function, researchers should consider:

  • Context-Dependent Responses: As observed with other olfactory receptors, behavioral responses may vary with social context and prior experience . Experimental designs should account for these variables by controlling pre-test conditions.

  • Sex-Specific Effects: Similar to what has been observed with Obp69a, Or69a function may differ between male and female flies . Separate analysis by sex is essential.

  • Stimulus Delivery: Precise control of odorant concentration and delivery is critical. Methods should include appropriate controls for solvent effects and ensure consistent delivery across treatments.

  • Quantitative Assessment: Automated tracking systems should be employed to objectively quantify behavioral parameters such as approach, avoidance, and dwell time in response to Or69a ligands.

What is known about the evolutionary conservation of Or69a across Drosophila species and other insects?

Evolutionary analysis of Or69a should examine:

  • Sequence Conservation: Comparative genomic analysis across Drosophila species and other insects can reveal conserved domains critical for ligand binding and signal transduction.

  • Functional Conservation: Cross-species functional studies can determine whether ligand specificity is maintained across evolutionary distance.

  • Expression Pattern Conservation: Analysis of receptor expression patterns across species can indicate conservation of neuronal circuit architecture.

Researchers studying evolutionary aspects should employ phylogenetic analysis tools and conduct functional assays in multiple species to track evolutionary changes in receptor properties.

How might Or69a contribute to behavioral plasticity in response to environmental and social cues?

Similar to Obp69a, which shows experience-dependent expression changes affecting behavioral outcomes, Or69a may play a role in olfactory plasticity. Based on insights from Obp69a research, potential mechanisms include:

  • Activity-Dependent Regulation: Neuronal activity in Or69a-expressing neurons might modulate receptor expression levels or sensitivity, similar to how cVA exposure regulates Obp69a expression .

  • Signal Integration: Or69a-expressing neurons may integrate multiple environmental cues beyond direct ligand binding, contributing to context-dependent responses.

  • Circuit-Level Plasticity: Or69a activation may trigger changes in downstream neural circuits that process olfactory information, altering behavioral responses based on experience.

Experimental approaches should include:

  • Measuring Or69a expression levels after different social experiences

  • Assessing behavioral responses to Or69a ligands before and after conditioning

  • Calcium imaging of Or69a neurons and their postsynaptic targets during learning paradigms

What are the challenges in differentiating between Or69a isoforms in experimental settings?

Like many Drosophila genes, Or69a may have multiple isoforms resulting from alternative splicing. Key challenges include:

  • Isoform-Specific Expression: Different isoforms may be expressed in distinct neuronal populations or developmental stages.

  • Functional Differences: Isoforms may exhibit different ligand specificities or coupling efficiencies to downstream signaling.

  • Technical Detection Limitations: Standard antibodies or hybridization probes may not distinguish between closely related isoforms.

Methodological solutions include:

  • Designing isoform-specific primers for RT-PCR analysis

  • Generating isoform-specific antibodies targeting unique epitopes

  • Creating transgenic constructs expressing individual isoforms for functional comparison

  • Employing isoform-specific CRISPR/Cas9 targeting strategies

How can contradictory findings about Or69a function be reconciled in the literature?

When facing contradictory findings about Or69a function, researchers should systematically address potential sources of variation:

  • Genetic Background Effects: Different laboratory strains of Drosophila may harbor genetic modifiers affecting Or69a function. Solution: Use identical genetic backgrounds or perform backcrossing to standardize backgrounds.

  • Methodological Differences: Variations in experimental techniques can produce seemingly contradictory results. Solution: Directly compare methods within the same study and explicitly state all experimental parameters.

  • Environmental Conditions: Factors such as temperature, which is known to affect plastic recombination in Drosophila , may also impact Or69a function. Solution: Strictly control and report environmental conditions.

  • Social Experience: Prior social interactions can modify olfactory responses . Solution: Standardize pre-test housing conditions and social experiences.

What controls are essential when studying Or69a in comparison to other olfactory receptors?

Rigorous experimental design requires multiple control types:

  • Genetic Controls: Include both driver-only and UAS-responder-only controls when using the GAL4-UAS system for receptor manipulation.

  • Receptor Specificity Controls: Test ligands against multiple receptors to establish specificity profiles. The DoOR (Database of Odorant Responses) approach, which combines data from multiple studies into a consensus response matrix, provides a useful framework .

  • Dose-Response Controls: Test multiple concentrations of ligands, as receptor responses can vary dramatically across concentration ranges.

  • Solvent Controls: Include appropriate solvent controls, as carriers like DMSO can themselves elicit responses.

  • Positive Controls: Include known ligands for Or69a (3-hydroxyhexanoate, alpha-terpineol, 3-octanol, linalool) as positive controls in every experiment.

How does Or69a function connect to studies of social behavior in Drosophila?

Based on patterns observed with other olfactory components like Obp69a, Or69a likely plays a role in social behaviors through:

  • Pheromone Detection: If Or69a responds to pheromones or social cues, it may directly mediate social behaviors such as courtship, aggression, or aggregation.

  • Experience-Dependent Plasticity: Similar to how Obp69a expression changes with social experience , Or69a sensitivity or expression may be modulated by social context, creating feedback loops between social experience and future social responsiveness.

  • Sex-Specific Functions: Given the sexually dimorphic regulation observed with Obp69a , Or69a may also show sex-specific functions in social behavior regulation.

Researchers bridging olfactory and social behavior fields should employ comprehensive behavioral assays while manipulating Or69a function specifically.

What is the relationship between Or69a and Wolbachia infection in Drosophila melanogaster?

While the search results don't directly address interactions between Or69a and Wolbachia, this question represents an interesting intersection of research areas:

  • Potential Modulation of Expression: Wolbachia infection influences host gene expression and can induce plastic recombination in Drosophila . It's possible that Wolbachia might affect Or69a expression levels or function.

  • Behavioral Effects: Wolbachia infection alters various aspects of host behavior in insects. If Or69a mediates behaviors that are also affected by Wolbachia, there may be functional interactions.

  • Experimental Approach: Researchers should compare Or69a expression and function in Wolbachia-infected versus uninfected fly lines with identical genetic backgrounds. Quantitative PCR (qPCR) methods similar to those used to measure Wolbachia titer could be applied to measure Or69a expression changes.

How can understanding Or69a function contribute to broader insect olfaction research?

Research on Or69a has broader implications for insect olfaction:

  • Comparative Receptor Biology: Findings from Or69a studies can inform understanding of receptor tuning and evolution across insect taxa.

  • Circuit Principles: The neural circuits processing Or69a signals likely employ computational principles that may be conserved across species.

  • Behavioral Plasticity Models: If Or69a mediates experience-dependent behavioral changes, it provides a model system for studying olfactory learning and memory.

  • Applied Entomology: Understanding insect olfactory receptors, including Or69a, contributes to development of novel strategies for controlling agricultural pests and disease vectors through manipulation of olfactory-guided behaviors.

Researchers should explicitly connect their Or69a findings to these broader contexts to maximize impact.

What emerging technologies will advance our understanding of Or69a function?

Several cutting-edge approaches show promise for Or69a research:

  • Cryo-Electron Microscopy: This technique could reveal the structural basis of Or69a ligand binding and receptor activation, providing insight into mechanisms of odorant recognition.

  • Connectomics: Comprehensive mapping of connections between Or69a neurons and their targets would illuminate how olfactory information is processed and integrated.

  • Optogenetics and Thermogenetics: These techniques allow precise temporal control of Or69a-expressing neurons, enabling researchers to dissect their contribution to behavior.

  • Single-Cell Transcriptomics: This approach can reveal the full molecular profile of Or69a-expressing neurons and how it changes with experience or environmental conditions.

What are the most significant unanswered questions about Or69a that warrant investigation?

Priority research questions include:

  • Molecular Activation Mechanism: What specific structural features of ligands are recognized by Or69a, and what conformational changes occur during activation?

  • Circuit Integration: How do Or69a-expressing neurons connect with higher brain centers, and how is their input integrated with other sensory modalities?

  • Behavioral Significance: What specific behaviors are mediated by Or69a activation in natural ecological contexts?

  • Developmental Regulation: How is Or69a expression regulated during development, and does its function change across life stages?

  • Experiential Plasticity: Similar to findings with Obp69a , does Or69a function or expression change with experience, and what molecular mechanisms mediate this plasticity?

Addressing these questions will require interdisciplinary approaches combining molecular, neurophysiological, and behavioral techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.