Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform B (Or69a)

Shipped with Ice Packs
In Stock

Description

Physical and Biochemical Properties

The commercially available recombinant Or69a protein is typically supplied as a lyophilized powder with a purity exceeding 90% as determined by SDS-PAGE analysis . The protein's stability is significantly affected by temperature variations, with recommendations indicating storage at -20°C or -80°C upon receipt. Aliquoting is necessary for multiple use scenarios, and repeated freeze-thaw cycles should be avoided to maintain protein integrity .

The following table summarizes the key biochemical characteristics of recombinant Or69a:

PropertyDescription
Protein LengthFull Length (1-393 amino acids)
TagN-terminal His tag
SourceExpressed in E. coli
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Recommended ReconstitutionDeionized sterile water (0.1-1.0 mg/mL with 5-50% glycerol)

Table 1: Biochemical properties of recombinant Or69a protein .

Expression and Localization in Drosophila

The Or69a gene is natively expressed in specific olfactory sensory neurons (OSNs) in the Drosophila olfactory system. Specifically, Or69a is expressed in ab9 neurons, which project their axons to innervate glomerulus D in the antennal lobe of the Drosophila brain . This specific expression pattern contributes to the spatial mapping of odorant information in the fly's olfactory system.

The integration of Or69a within the comprehensive DoOR (Database of Odorant Responses) project has provided valuable insights into its functional role in the context of the entire Drosophila olfactome. The DoOR project combines heterogeneous datasets from various studies to create a consensus response matrix for all Drosophila odorant receptors, enabling a systematic understanding of olfactory coding principles .

Or69a in the Context of Drosophila Olfactome

The DoOR project's comprehensive mapping of Drosophila odorant responses includes Or69a among the nearly complete set of deorphanized odorant receptors. Through calcium imaging techniques, researchers have characterized the response profile of Or69a to approximately 106 odorants, revealing a remarkably broad response spectrum . This extensive characterization has contributed to understanding how the combinatorial activation of different odorant receptors encodes olfactory information in the fruit fly.

Functional Properties and Ligand Specificity

A distinctive feature of Or69a is its exceptionally broad response spectrum. Among the characterized Drosophila odorant receptors, Or69a demonstrates activity towards most odorants in experimental test sets, with a calculated receptor kurtosis of -0.36 . This broad tuning contrasts with more selectively tuned odorant receptors in the Drosophila olfactory system.

Identified Ligands and Response Profile

Through systematic deorphanization efforts, researchers have identified several potent ligands for Or69a. The strongest responses were observed for:

  1. Ethyl 3-hydroxyhexanoate

  2. Alpha-terpineol

  3. 3-octanol

  4. Linalool

These compounds represent diverse chemical classes, which aligns with the observation that chemical class is not a reliable predictor of receptor activation patterns. The researchers note that it is not appropriate to characterize Or69a (or other odorant receptors) simply as an "alcohol receptor" or "ester receptor," as the response profiles span multiple chemical categories .

The following table represents a subset of the comprehensive odorant response data for Or69a:

LigandChemical ClassResponse StrengthNotes
Ethyl 3-hydroxyhexanoateEsterHighStrongest identified ligand
Alpha-terpineolAlcohol (Terpene)HighAmong top activators
3-octanolAlcoholHighAmong top activators
LinaloolAlcohol (Terpene)HighAmong top activators
Various other compoundsMixedLow to moderateBroad response profile

Table 2: Key odorant ligands for Or69a and their relative response strengths .

Research Applications and Significance

The recombinant Or69a protein has significant research applications in various aspects of olfactory neuroscience and molecular biology. The availability of purified recombinant protein enables detailed structural and functional studies that contribute to understanding the molecular basis of odorant detection.

Applications in Olfactory Research

The recombinant Or69a protein is suitable for several research applications, including:

  1. Structure-function studies: Investigating the relationship between protein structure and odorant recognition capabilities.

  2. Ligand binding assays: Characterizing the binding affinity and specificity of various odorants to the receptor.

  3. Antibody development: Generating specific antibodies for immunolocalization studies in Drosophila tissues.

  4. Functional reconstitution: Incorporating the receptor into artificial membrane systems to study its functional properties in isolation .

These applications contribute to the broader understanding of olfactory coding principles and the molecular mechanisms underlying odorant detection.

Handling and Experimental Considerations

For optimal experimental outcomes, specific handling protocols are recommended when working with recombinant Or69a protein. Prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is advised, with the addition of 5-50% glycerol (final concentration) for long-term storage stability . Working aliquots can be stored at 4°C for up to one week, but longer-term storage requires -20°C or -80°C temperatures to maintain protein integrity .

Comparative Analysis with Related Odorant Receptors

The Drosophila olfactory system comprises 39 odorant receptor genes expressed in the antenna . Each of these receptors contributes to the fly's ability to detect and discriminate odors in its environment. Or69a represents just one component of this complex system, with its distinctive broad tuning characteristics.

Recent research has revealed additional complexity in the regulation of odorant receptor gene expression in Drosophila. While not specifically reported for Or69a, exitron splicing (splicing of intronic sequences within exons) has been identified in four other Drosophila odorant receptor genes . This post-transcriptional regulation mechanism adds another layer of complexity to the already sophisticated olfactory coding system.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly include them in your order remarks. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or69a; Or69b; CG32116; Putative odorant receptor 69a, isoform B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or69a
Target Protein Sequence
MQLEDFMRYPDLVCQAAQLPRYTWNGRRSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYG YFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKH RAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYP WQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARN PHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLK HLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPY MWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK
Uniprot No.

Target Background

Function
Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a vast collection of odor stimuli that vary significantly in identity, intensity, and duration. It may form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG33264

UniGene: Dm.26498

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.