Recombinant Drosophila melanogaster Putative odorant receptor 82a (Or82a)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Drosophila melanogaster Putative odorant receptor 82a (Or82a) is a narrowly tuned odorant receptor (OR) belonging to the OR gene family in D. melanogaster. It is primarily expressed in ab5 olfactory sensory neurons (OSNs) and exhibits high specificity for geranyl acetate (GAc), a volatile organic compound present in plant-derived odors . As a recombinant protein, Or82a is often expressed in heterologous systems to study its molecular interactions, ligand-binding properties, and functional contributions to olfactory perception.

Ligand-Binding and Olfactory Signaling

Or82a’s narrow tuning is critical for detecting specific odorants in environmental contexts. Below are key findings from functional studies:

Ligand Specificity and Response Profiles

  • Geranyl Acetate (GAc): Or82a exhibits high sensitivity to GAc, with robust spiking responses in single sensillum recordings .

  • Citral and Other Odorants: No significant response to citral or structurally unrelated odorants, confirming its specificity .

Response Index Data for Or82a:

OdorantConcentration (v/v)Response IndexSource
Geranyl Acetate1:100 in mineral oil0.8–1.0 (High)
Citral1:100 in mineral oil0.0–0.2 (Low)

Role in Olfactory Perception

Or82a’s activity is independent of CYP-mediated odorant processing. Mutations in Cyp4p1 or Cyp6a8 did not alter Or82a-dependent responses to GAc, suggesting direct ligand-receptor interactions dominate its signaling .

Transgenic Manipulation

  • GAL80 Collection: Or82a-expressing neurons were silenced using Or82a-GAL4 and GAL80 transgenes to nullify transgene expression. This system confirmed Or82a’s role in GAc detection .

  • Optogenetic Stimulation: While not directly tested in Or82a, similar approaches in other receptors (e.g., Or22a) highlight the utility of optogenetics for isolating OSN responses .

Comparative Analyses with Other ORs

ReceptorLigand SpecificityResponse BreadthFunctional RoleSource
Or82aNarrow (GAc)Single odorantDetection of specific plant volatiles
Or22aBroad (multiple esters)Multiple odorantsLong-range odor-guided behavior

Implications for Olfactory Research

Or82a’s narrow tuning exemplifies how specific ORs enable precise odor discrimination. Its independence from CYP-mediated processing highlights the diversity of olfactory signaling mechanisms . Future studies could explore:

  1. Structural Determinants: Residue-level analysis of Or82a’s binding pocket to map GAc interactions.

  2. Behavioral Relevance: Linking Or82a activity to ecological behaviors, such as host plant selection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Or82a; CG31519; Odorant receptor 82a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or82a
Target Protein Sequence
MGRLFQLQEYCLRAMGHKDDMDSTDSTALSLKHISSLIFVISAQYPLISYVAYNRNDMEK VTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAEAN KLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYE VCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQIRLKS IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGS IMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFF VASLANFVGICRTALSLITLIKSIE
Uniprot No.

Target Background

Function

Or82a is an odorant receptor in Drosophila melanogaster that mediates acceptance or avoidance behaviors depending on the substrate. The diverse odorant receptor repertoire allows for the detection of a wide range of odor stimuli, varying in identity, intensity, and duration. Or82a may form a complex with Orco, creating odorant-sensing units that facilitate sensitive and sustained odorant signaling and calcium permeability.

Database Links

KEGG: dme:Dmel_CG31519

STRING: 7227.FBpp0078616

UniGene: Dm.26572

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is Or82a and where is it expressed in Drosophila melanogaster?

Or82a is a member of the odorant receptor (OR) family in Drosophila melanogaster that functions in detecting specific volatile compounds. It is expressed in the ab5A olfactory sensory neurons (OSNs) housed within basiconic sensilla on the Drosophila antenna . These neurons project to the VA6 glomerulus in the antennal lobe, which has been characterized as having positive valence (associated with attractive behaviors) . Or82a expression is part of the broader olfactory system architecture where OSNs expressing the same receptor converge their axons onto specific glomeruli, creating a spatial map of odor representation in the brain.

How does Or82a fit into the co-receptor expression pattern in Drosophila olfactory system?

The traditional view that olfactory neurons express only one chemosensory receptor family has been challenged by recent findings. Drosophila has two main olfactory receptor gene families: odorant receptors (ORs) and ionotropic receptors (IRs) . Or82a belongs to the OR family and requires the co-receptor Orco for proper function, similar to other ORs . Recent genetic knock-in studies have revealed extensive overlap in expression among different co-receptors in Drosophila olfactory neurons . While specific data on Or82a co-expression patterns isn't detailed in the available literature, the widespread co-expression of chemosensory receptors observed in insect olfactory neurons suggests Or82a may also participate in more complex receptor interactions than previously thought .

What is known about the morphological characteristics of Or82a-expressing neurons?

Systematic morphological and morphometric analyses using serial block-face electron microscopy (SBEM) have provided detailed 3D reconstructions of Drosophila OSNs . While specific details for Or82a neurons are not explicitly provided in the literature, general observations about basiconic sensilla housing receptors like Or82a include:

  • More intricate dendritic branching patterns than previously appreciated with the "paintbrush model"

  • Considerable variability in dendritic branching and morphology among neurons expressing the same receptor

  • Diverging points in dendrites are numerous, and branches can bifurcate or converge with others

  • Potential differences in mitochondrial abundance between partner neurons in the same sensillum

These morphological features likely influence the olfactory function of Or82a-expressing neurons, affecting their sensitivity, specificity, and temporal response properties .

What are the primary ligands for Or82a and how selective is its response profile?

Or82a responds strongly and selectively to geranyl acetate, which appears to be its primary ligand . It also shows responses to citral, though the relative strength of this response compared to geranyl acetate is not specified in the available literature . Or82a is characterized as a "narrowly tuned receptor," responding to relatively few compounds, in contrast to broadly tuned receptors like Or22a and Or85b that respond to many different odorants . This selective response profile suggests that Or82a plays a specialized role in detecting specific environmental cues, likely related to particular plant volatiles.

How can response properties of Or82a be quantitatively characterized?

Single sensillum recordings (SSR) are commonly used to characterize the electrophysiological properties of Or82a. Standard approaches for quantitative characterization include:

  • Response magnitude to brief (500 ms) pulses of odorants, measured in spikes per second

  • Dose-response curves to determine EC50 values (the concentration at which half-maximal response is achieved)

  • Analysis of response kinetics using peristimulus time histograms to quantify instantaneous firing frequency over extended time periods

For example, studies have examined Or82a responses to geranyl acetate across different concentrations to generate dose-response relationships and determine sensitivity thresholds . Such quantitative approaches allow comparison of Or82a properties with other olfactory receptors and assessment of how genetic or environmental manipulations affect its function.

Do Or82a-expressing neurons exhibit response plasticity?

While the literature doesn't directly address plasticity in Or82a-expressing neurons, studies on other Drosophila OSNs provide relevant insights. Research on sensitization (enhanced responses following repeated stimulation) indicates that this property may be linked to the behavioral significance of the neuron rather than the tuning properties of the receptor . Given that Or82a neurons project to the positively-valenced VA6 glomerulus associated with attractive behaviors , they might exhibit plasticity mechanisms similar to other food odor-detecting neurons.

Research on other receptors has shown that sensitization can be differently regulated in distinct neuronal compartments (e.g., being exclusively calmodulin-dependent in the outer dendrites) . This suggests that plasticity in Or82a neurons would likely involve complex cellular mechanisms beyond the receptor itself.

What are the optimal methods for functionally characterizing Or82a in vivo?

Single sensillum recording (SSR) is the gold standard for studying the electrophysiological properties of Or82a-expressing neurons in vivo . For optimal recordings from Or82a neurons:

  • Identify ab5 sensilla on the Drosophila antenna based on their morphology and position

  • Insert a glass electrode into the base of the sensillum with a reference electrode in the eye or body

  • Confirm sensillum identity by testing responses to geranyl acetate, which should elicit strong responses

  • Isolate activity of the ab5A neuron (expressing Or82a) based on spike amplitude, as the 'A' neuron typically produces larger amplitude spikes than its partner 'B' neuron

  • Present odor stimuli using a controlled delivery system for precise timing and concentration

This approach allows measurement of response magnitudes, temporal dynamics, and dose-dependent effects of various odorants on Or82a-expressing neurons .

How can one generate and validate recombinant Or82a for heterologous expression studies?

While specific protocols for recombinant Or82a expression are not detailed in the provided literature, the following approach based on methods used for other Drosophila odorant receptors would be applicable:

  • Clone the full-length Or82a coding sequence from Drosophila antennal cDNA

  • Insert the sequence into an appropriate expression vector with a strong promoter

  • Co-express with the Orco co-receptor, which is required for proper function

  • Use a heterologous expression system such as:

    • HEK293 cells (human embryonic kidney cells)

    • Xenopus oocytes (for electrophysiological studies)

    • Sf9 insect cells (which may provide a more native-like environment)

For functional validation, compare responses to known ligands (geranyl acetate and citral) between the heterologous system and native neurons using calcium imaging or electrophysiology. Previous research has shown that some odorant receptors display different properties when expressed in heterologous systems versus their native environment , highlighting the importance of comparative validation.

What genetic tools are available for manipulating Or82a expression in Drosophila?

Several genetic approaches can be used to manipulate Or82a expression:

  • RNAi knockdown using the GAL4/UAS system with appropriate drivers active in developing or mature OSNs

  • CRISPR/Cas9 gene editing to generate precise modifications or null mutations in the Or82a locus

  • Genetic knock-in strategies similar to those used for co-receptor studies

  • Or82a-GAL4 driver lines to express reporter genes or effectors specifically in Or82a-expressing neurons

For visualization of Or82a-expressing neurons, approaches include:

  • Membrane-tethered EM markers (APEX2-mCD8GFP) expressed under the Or82a promoter

  • Immunohistochemistry with antibodies against Or82a or co-expressed markers

  • RNA in situ hybridization with probes specific to Or82a mRNA

These tools enable diverse experimental approaches, from analyzing the effects of Or82a mutations on odor perception to tracing the connectivity of Or82a neurons in the olfactory circuit.

How do mutations in Or82a affect olfactory-guided behaviors in Drosophila?

Or82a neurons project to the VA6 glomerulus, which has been characterized as having "positive valence," meaning activation of these neurons typically contributes to attractive behaviors . Research has shown that activation of even a single OSN type can be sufficient to initiate behavioral responses such as flight surges at low odor concentrations . Given Or82a's selective response to plant volatiles like geranyl acetate, mutations would likely specifically affect:

  • Detection thresholds for geranyl acetate and related compounds

  • Food-finding behaviors, particularly those involving plants containing these compounds

  • Potential downstream effects on mating and oviposition, which often occur at food sites

A comprehensive behavioral analysis would require generating Or82a mutants and testing their responses across multiple behavioral paradigms, including flight tracking, walking assays, and oviposition preference tests with controlled presentation of relevant odorants.

How can contradictions in Or82a functional data be reconciled?

When encountering contradictory results regarding Or82a function across different studies, consider these methodological approaches for reconciliation:

  • Examine expression system differences:

    • Heterologously expressed receptors may show different properties than in vivo neurons

    • Different cellular compartments (e.g., outer dendrites vs. soma) may exhibit distinct regulatory mechanisms

  • Consider genetic background effects:

    • Control for genetic background differences between Drosophila strains

    • Evaluate potential interactions with modifier genes that vary between genetic backgrounds

  • Assess methodological variations:

    • Compare stimulation parameters (concentration, duration, delivery method)

    • Standardize recording techniques and analysis methods

  • Investigate developmental or physiological state differences:

    • Age of flies used in experiments

    • Feeding status, which can affect olfactory sensitivity

    • Prior odorant exposure, which may induce adaptation or sensitization

Resolving such contradictions requires careful replication experiments controlling for these variables, ideally performed side-by-side to directly compare conditions.

How does the molecular structure of Or82a relate to its ligand specificity?

While the provided literature doesn't contain specific structural information about Or82a, understanding the relationship between receptor structure and ligand specificity would involve:

  • Comparative sequence analysis:

    • Align Or82a sequences with other ORs of known ligand specificity

    • Identify conserved motifs and variable regions potentially involved in ligand binding

  • Structure-function analysis:

    • Generate point mutations or chimeric receptors with other ORs

    • Test responses to geranyl acetate and structurally related compounds

    • Map critical residues for ligand binding and channel function

  • Computational modeling:

    • Generate homology models based on available GPCR or ion channel structures

    • Perform docking simulations with known ligands

    • Predict binding pocket characteristics

This approach would help identify the molecular determinants of Or82a's narrow tuning to geranyl acetate and potentially guide the design of compounds with enhanced or inhibitory effects on receptor function.

How can Or82a be utilized in biosensor development for environmental monitoring?

Or82a's narrow tuning to specific plant volatiles makes it a promising candidate for biosensor applications. Development of an Or82a-based biosensor would involve:

  • Expression system optimization:

    • Stable cell lines co-expressing Or82a and Orco

    • Integration with signal transduction reporters (calcium indicators, voltage sensors)

  • Detection system development:

    • Microfluidic platforms for controlled sample delivery

    • Optical or electrical signal detection and amplification

    • Data processing algorithms for real-time analysis

  • Validation and calibration:

    • Determine sensitivity, specificity, and dynamic range using purified compounds

    • Test performance in complex mixtures and environmental samples

    • Compare with standard analytical chemistry methods (GC-MS)

Potential applications include monitoring plant volatile emissions in agricultural settings, quality control in the fragrance industry, and research tools for studying plant-insect chemical ecology.

How conserved is Or82a function across different Drosophila species?

While the provided literature doesn't directly address Or82a conservation, insights can be drawn from related findings. Co-expression patterns of olfactory co-receptors have been observed in both Drosophila melanogaster and Drosophila sechellia, suggesting some conservation of olfactory receptor expression across species . Additionally, co-expression of Orco and Ir25a has been found in Anopheles coluzzii, indicating conservation across more distantly related insect lineages .

A comprehensive comparative analysis of Or82a would examine:

  • Sequence conservation across Drosophila species and other insects

  • Expression pattern conservation in homologous sensilla

  • Functional conservation of response properties to geranyl acetate and other ligands

  • Ecological correlations between Or82a variations and species-specific host preferences

Such studies would provide insights into the evolution of specialized olfactory receptor functions and their role in ecological adaptation.

How does Or82a function integrate with the broader olfactory coding network?

Understanding how Or82a contributes to olfactory coding requires considering its role within the broader neural network:

Research approaches would include:

  • Circuit tracing from Or82a neurons to identify downstream connections

  • Calcium imaging to observe how Or82a activation influences activity across the antennal lobe

  • Behavioral assays combining Or82a ligands with other odorants to assess integration effects

This systems-level understanding would place Or82a function in the context of holistic odor perception and behavioral decision-making.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.