Recombinant Drosophila melanogaster Putative odorant receptor 83a (Or83a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

Or83a belongs to the Drosophila odorant receptor family, which detects volatile chemicals through olfactory sensory neurons (OSNs). Unlike co-receptors like Or83b (Orco) that dimerize with other ORs for signal transduction, Or83a is classified as a "conventional" OR with potential ligand-specific activation . Key functional insights:

  • Co-receptor Dependency: Conventional ORs like Or83a likely require Or83b for dendritic localization and ion channel function, as demonstrated in studies of homologous receptors .

  • Broad Expression: Co-receptors such as Ir25a overlap with Or83a in 82% of Orco+ neurons, suggesting complex combinatorial coding in odor detection .

Research Applications

Recombinant Or83a facilitates mechanistic studies of insect olfaction:

  • Ligand Screening: Used in heterologous systems (e.g., Xenopus oocytes or Drosophila ab3A neurons) to identify odorant ligands .

  • Structural Studies: Enables crystallography or cryo-EM to resolve receptor-ligand binding interfaces.

  • Genetic Models: Supports CRISPR/Cas9-based studies to dissect Or83a’s role in behavior or neuronal circuits .

Comparative Analysis with Other Drosophila Receptors

FeatureOr83a (Conventional OR)Or83b (Co-receptor)
ExpressionSubset of OSNsBroadly expressed in OSNs
FunctionBinds specific odorantsEssential for OR trafficking
Genetic RedundancyLow (specialized ligands)High (required for all ORs)

Limitations and Technical Notes

  • Instability: Repeated freeze-thaw cycles degrade activity; aliquot storage at -80°C is recommended .

  • Ligand Unknowns: Or83a’s specific odorant targets remain uncharacterized, unlike deorphanized receptors like Or19A1 in D. suzukii .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly specify your needs during order placement, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or83a; CG10612; Odorant receptor 83a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or83a
Target Protein Sequence
MKSTFKEERIKDDSKRRDLFVFVRQTMCIAAMYPFGYYVNGSGVLAVLVRFCDLTYELFN YFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGLLNTILS NINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLAC WYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLA SSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSF VRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQ YLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLT AGKISNLNVDRFRGTITTAFSFLTLLQKMDARE
Uniprot No.

Target Background

Function
Odorant receptor 83a (Or83a) is a protein in Drosophila melanogaster that mediates acceptance or avoidance behavior in response to odorants. The diversity of odorant receptors allows for the detection of a wide range of odor stimuli, varying in identity, intensity, and duration. Or83a may form a complex with Orco, creating odorant-sensing units that enable sensitive and prolonged odorant signaling and calcium permeability. This receptor plays a crucial role in the behavioral responses to pentanol, ethyl acetate, and propyl acetate.
Database Links

KEGG: dme:Dmel_CG10612

STRING: 7227.FBpp0078441

UniGene: Dm.5196

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Drosophila melanogaster odorant receptors, and how does Or83a compare to other family members?

Drosophila odorant receptors (ORs) are seven-transmembrane domain proteins with an atypical membrane topology compared to vertebrate olfactory receptors. Unlike classical G-protein coupled receptors, Drosophila ORs and the highly conserved co-receptor OR83b have their N-termini and most conserved loops positioned in the cytoplasm rather than extracellularly . Or83a belongs to this family of approximately 57 odorant receptor genes identified in the Drosophila genome .

The structure of Or83a should be considered in relation to OR83b (also known as Orco), which is significantly larger at 486 amino acids compared to conventional ORs that are typically 370-400 amino acids in length. The additional amino acids in OR83b are predominantly located in predicted intracellular loop regions . While specific structural data on Or83a is limited in the provided context, its function would likely follow the heterodimeric model observed with other conventional ORs, where it partners with OR83b to form functional receptor complexes.

How are odorant receptors like Or83a expressed in Drosophila olfactory sensory neurons?

Drosophila odorant receptors display a highly organized expression pattern. Conventional ORs, including putatively Or83a, follow a general rule where each olfactory sensory neuron (OSN) expresses only one conventional OR gene along with the broadly expressed co-receptor OR83b . This expression pattern is spatially conserved between animals and shows bilateral symmetry .

Expression occurs in specific spatial domains of the main olfactory organs (antennae and maxillary palps). For example, OR43a is expressed in the lateral distal domain of the antenna, while OR71a is expressed in the maxillary palps . The expression pattern of any given OR is consistent between individual flies, creating a stereotyped "map" of receptor expression. This spatial organization subsequently influences the connectivity patterns of OSNs to specific glomeruli in the brain, establishing the foundation for odor processing.

What are the preferred methods for generating recombinant Drosophila Or83a for functional studies?

For recombinant expression of Drosophila ORs including Or83a, site-specific genomic targeting provides a powerful approach. A transposon vector-based method has been developed that allows transgene targeting to predefined chromosomal sites in Drosophila . This approach offers significant advantages over random insertion methods.

The methodology involves using FLP recombinase-mediated cassette exchange (RMCE) with specialized donor plasmids containing FRT and FRT3 recombination sites flanking the transgene of interest . For instance, to express recombinant Or83a:

  • Design a donor plasmid containing the Or83a coding sequence flanked by FRT/FRT3 sites

  • Inject this construct into embryos of Drosophila lines containing compatible target docking sites

  • Screen for successful recombinants using selectable markers (e.g., fluorescent proteins like EYFP)

  • Confirm proper integration and expression through genomic PCR and gene expression analysis

This technique yields integration efficiencies comparable to conventional P element-based transformation protocols (approximately 22-31% of fertile male injection survivors produce offspring with the desired phenotype) . For functional studies, co-expression with OR83b is typically necessary as it forms an essential heterodimeric complex with conventional ORs for proper trafficking and function .

How can researchers optimize gene expression analysis for Or83a studies?

Optimizing gene expression analysis for Or83a studies requires careful attention to quality control metrics and normalization procedures. When using nCounter or similar technologies, researchers should:

  • Monitor binding density metrics to ensure optimal data collection (0.1-2.25 for MAX/FLEX instruments or 0.1-1.8 for SPRINT instruments)

  • Evaluate positive control linearity (R² should be >0.95) to confirm assay performance

  • Examine both positive and negative controls to assess assay sensitivity and background levels

  • Apply appropriate normalization methods to account for technical variation

Factors that can affect binding density and subsequently data quality include assay input quantity, expression level of target genes, and the size of the probe set . For Or83a specifically, researchers should consider its expression level relative to other ORs and adjust input quantities accordingly to prevent saturation or insufficient signal.

For gene expression data with potential flags in quality control metrics, researchers should examine the extent of deviation from thresholds rather than automatically discarding data. Minor deviations (e.g., FOV registration at 72% versus the recommended 75% threshold) may still yield usable data, while major deviations suggest critical quality issues .

What functional assays are most effective for characterizing Or83a ligand interactions?

The characterization of ligand interactions with Or83a requires approaches that account for the heterodimeric nature of functional Drosophila odorant receptors. The most effective functional assays include:

  • Heterologous Expression Systems: Express recombinant Or83a together with OR83b in cell lines (e.g., HEK293, Xenopus oocytes) to measure ligand-induced responses through calcium imaging or electrophysiology .

  • In vivo Electrophysiology: Single sensillum recordings (SSR) from Drosophila antennae expressing Or83a provide direct measurements of neuronal responses to odor stimuli under physiological conditions.

  • OR/OR83b Reconstitution Assays: The OR/OR83b complex is necessary and sufficient to reconstitute odor-evoked signaling in sensory neurons that normally do not respond to the odors of interest . This can be leveraged to assess Or83a function by expressing it with OR83b in neurons that typically respond to other stimuli (e.g., carbon dioxide).

  • Behavioral Assays: Transgenic flies with modified Or83a expression can be tested in behavioral paradigms to correlate receptor function with behavioral outcomes.

When designing these experiments, researchers should consider the atypical membrane topology of Drosophila ORs, as this impacts how the receptor interacts with ligands and coupling mechanisms . Additionally, the direct association between conventional ORs and OR83b occurs through cytoplasmic loops, highlighting the importance of maintaining these structural elements in recombinant constructs .

How can the function of Or83a be assessed in the context of the broader olfactory system?

Assessing Or83a function within the broader olfactory system requires integrative approaches that connect molecular mechanisms to circuit-level processing and behavioral outputs:

  • Glomerular Mapping: Determine which specific glomerulus in the antennal lobe receives projections from OSNs expressing Or83a. This can be achieved through genetic labeling techniques using OR-Gal4 driver lines coupled with UAS-reporter constructs .

  • Circuit Tracing: Employ trans-synaptic tracers to identify second-order projection neurons and higher-order neurons connected to Or83a-expressing OSNs.

  • Functional Imaging: Use calcium or voltage imaging to visualize odor-evoked activity patterns in the antennal lobe and higher brain centers in response to Or83a ligands.

  • Selective Manipulation: Apply optogenetic or thermogenetic tools to specifically activate or silence Or83a-expressing neurons and observe effects on downstream neural activity and behavior.

  • Comparative Analysis: Compare Or83a expression and function with other ORs to understand its specific contribution to odor coding.

These approaches should be designed with the understanding that each adult olfactory neuron expresses only one conventional OR gene along with OR83b , creating a specialized detection channel within the olfactory system.

What are the challenges in distinguishing the role of Or83a from other closely related odorant receptors?

Distinguishing the specific role of Or83a from other closely related odorant receptors presents several significant challenges:

  • Low Sequence Homology: Drosophila odorant receptors exhibit extremely low sequence similarity within the family, making it difficult to predict functional relationships based on sequence alone . This complicates the identification of functionally redundant receptors that might compensate for Or83a.

  • Overlapping Ligand Specificity: Multiple odorant receptors may respond to the same odorants with different sensitivities, creating complex overlapping receptive fields that obscure the unique contribution of Or83a.

  • Expression Pattern Verification: Confirming the non-overlapping expression of Or83a with other specific OR genes requires technically demanding two-color in situ hybridization or dual-reporter strategies .

  • Heterodimeric Requirement: The obligate partnership with OR83b adds complexity to functional studies, as both partners must be present for proper receptor function .

To address these challenges, researchers should employ comprehensive approaches including:

  • Precise genetic manipulation techniques like CRISPR-Cas9 to modify Or83a while leaving other receptors intact

  • Systematic testing of odorant panels against both wild-type and Or83a-modified systems

  • Detailed resolution of spatial expression patterns using single-cell transcriptomics

  • Development of Or83a-specific antibodies for protein-level detection and localization

How does the atypical membrane topology of Drosophila odorant receptors impact experimental design for Or83a studies?

The atypical membrane topology of Drosophila odorant receptors, with N-termini and conserved loops in the cytoplasm, significantly impacts experimental design for Or83a studies in several ways :

  • Heterologous Expression Systems: Expression constructs must account for the inverted topology compared to vertebrate GPCRs. Standard GPCR expression vectors may need modification to ensure proper membrane insertion and orientation.

  • Functional Mapping: Studies aimed at identifying functional domains must consider that conserved loops mediate the direct association between conventional ORs and OR83b . For Or83a, mutagenesis strategies should prioritize these cytoplasmic interaction domains.

  • Antibody Development: Epitope tags must be placed at locations that preserve membrane topology and protein function. For instance, N-terminal tags would be located in the cytoplasm rather than extracellularly.

  • Trafficking Studies: The OR/OR83b complex formation occurs early in the endomembrane system , requiring experimental designs that can track receptor biogenesis, transport, and maintenance in sensory cilia.

  • Ligand Binding Site Identification: The inverted topology suggests ligand binding mechanisms distinct from vertebrate ORs, necessitating alternative approaches to identify and characterize binding pockets.

This atypical design represents an insect-specific solution for odor recognition , making it essential to adapt experimental protocols originally developed for vertebrate systems.

What are the best practices for analyzing gene expression data for Or83a in different experimental contexts?

Analysis of Or83a gene expression data requires careful attention to quality control, normalization, and statistical approaches that account for the biological context:

  • Quality Assessment Pipeline:

    • Evaluate binding density metrics to ensure data lies within acceptable ranges (0.1-2.25 for MAX/FLEX instruments)

    • Confirm positive control linearity (R² > 0.95) to validate assay performance

    • Examine FOV registration (should exceed 75%) to ensure proper imaging

    • Assess limit of detection using negative control probes

  • Normalization Strategy:

    • For tissue-specific studies, normalize Or83a expression to stable reference genes expressed in olfactory tissues

    • When comparing across developmental stages, use stage-invariant reference genes

    • Consider housekeeping gene normalization or global normalization approaches depending on experimental design

  • Experimental Comparisons:

    • For knockout/knockdown studies, compare expression ratios between experimental and control samples

    • In developmental studies, analyze expression patterns across multiple timepoints

    • For spatial expression analysis, correlate expression levels with anatomical locations

  • Statistical Analysis:

    • Apply appropriate statistical tests based on data distribution and experimental design

    • Consider biological replicates (different animals) separately from technical replicates

    • Adjust for multiple comparisons when analyzing Or83a alongside other OR genes

When analyzing flagged data, researchers should examine both the magnitude and pattern of QC metric deviations. Minor binding density flags alone may not compromise data quality, but combined QC failures across multiple metrics typically indicate problematic samples .

How can researchers integrate Or83a functional data with broader olfactory system models?

Integrating Or83a functional data with broader olfactory system models requires multidisciplinary approaches that connect molecular function to systems-level organization:

What are the most effective strategies for targeted genetic manipulation of Or83a in Drosophila?

Several genetic manipulation strategies are particularly effective for studying Or83a in Drosophila:

  • Site-Specific Recombination: The FLP recombinase-mediated cassette exchange (RMCE) system enables precise integration of Or83a variants at predefined genomic loci . This approach utilizes:

    • FRT and FRT3 recombination sites flanking the target cassette

    • Selection markers such as EYFP to identify successful recombinants

    • Integration efficiencies comparable to standard transformation methods (22-31%)

  • CRISPR-Cas9 Genome Editing:

    • Design guide RNAs targeting specific regions of Or83a

    • Introduce precise mutations or modifications using homology-directed repair

    • Generate complete knockouts through non-homologous end joining

  • OR-Gal4/UAS System:

    • Create Or83a-Gal4 driver lines that express the transcriptional activator Gal4 in Or83a-expressing neurons

    • Combine with UAS-reporter constructs to visualize expression patterns

    • Utilize UAS-RNAi or UAS-dominant negative constructs for functional manipulation

  • Heterologous Reconstitution:

    • Express Or83a along with OR83b in "empty neuron" systems that lack endogenous receptors

    • Test functional properties in neurons that normally respond to other stimuli

    • Assess sufficiency of Or83a/OR83b for conferring specific odor responses

When implementing these strategies, researchers should consider the spatial expression pattern of Or83a and design experiments that maintain the one-OR-per-neuron rule characteristic of Drosophila olfactory organization .

How can researchers effectively monitor and validate Or83a expression in genetically modified systems?

Effective monitoring and validation of Or83a expression in genetically modified systems requires multiple complementary approaches:

  • Molecular Validation:

    • RT-PCR and qPCR to quantify transcript levels

    • RNA in situ hybridization to confirm spatial expression patterns

    • Single-cell transcriptomics to verify the one-receptor-per-neuron rule

  • Protein Detection:

    • Immunohistochemistry using antibodies against Or83a or epitope tags

    • Western blotting to confirm protein expression levels

    • Subcellular localization studies to verify proper membrane targeting

  • Functional Validation:

    • Electrophysiological recordings to confirm ligand-induced responses

    • Calcium imaging to visualize neuronal activation

    • Behavioral assays to assess functional consequences of genetic modifications

  • Quality Control Metrics:

    • Binding density assessment for gene expression assays (0.1-2.25 range for optimal results)

    • Linearity testing with positive controls (R² > 0.95)

    • Analysis of negative controls to establish background thresholds

For visualization of expression patterns, researchers can use approaches similar to those demonstrated for other ORs, such as Or43a-Gal4:UAS-lacZ or Or71a-Gal4:UAS-lacZ systems that reveal the bilateral symmetry and spatial conservation of receptor expression .

How does Or83a compare functionally and structurally with homologous receptors in other insect species?

Comparative analysis of Or83a with homologous receptors in other insect species presents significant challenges due to the extremely low sequence similarity of ORs within Drosophila and between Drosophila and other insects . Nevertheless, several approaches can yield valuable insights:

  • Sequence Analysis Challenges:

    • Conventional approaches using degenerate PCR or low stringency hybridization are unlikely to succeed in identifying cross-species homologs because regions of homology are extremely dispersed

    • BLAST algorithms may identify potential homologs, but experimental validation is essential

  • Functional Conservation:

    • Despite sequence divergence, functional roles may be conserved

    • Comparative odor response profiles between species can identify functional homologs

    • Analysis of expression patterns in corresponding olfactory organs can suggest functional equivalence

  • Co-receptor Relationships:

    • The relationship with OR83b (Orco), which is highly conserved across insect species, provides a reference point for comparative studies

    • The heterodimeric requirement with OR83b appears to be an insect-specific solution for odor recognition

  • Evolutionary Considerations:

    • The divergent sequences of insect ORs suggest rapid evolution, potentially driven by ecological specialization

    • Analysis of selective pressure on different receptor domains can reveal functionally important regions

    • Genomic organization and chromosomal location may provide clues about evolutionary relationships

Recent advances in genomic sequencing technology make it increasingly feasible to identify and study OR repertoires in various insect species, including moth, locust, honeybee, ant, and cockroach , facilitating more comprehensive comparative analyses.

What is the evolutionary significance of the Or83a receptor in Drosophila melanogaster's ecological niche?

The evolutionary significance of Or83a in Drosophila melanogaster's ecological niche must be considered within the context of the species' olfactory system organization and environmental adaptations:

  • Olfactory System Organization:

    • Drosophila melanogaster employs approximately 57 odorant receptor genes to detect thousands of diverse odorants

    • The stereotyped expression pattern of receptors, including Or83a, creates a consistent neural code for odor detection across individuals

    • This organization represents an evolutionary solution to the challenge of detecting and discriminating diverse chemical stimuli with limited genetic resources

  • Specialized Detection Channels:

    • Each OSN expresses only one conventional OR gene along with OR83b

    • This one-receptor-per-neuron rule creates specialized detection channels that may have evolved to recognize ecologically relevant odorants

    • Or83a likely plays a specific role in detecting compounds important for survival, reproduction, or resource location

  • Ecological Context:

    • The specific odorants detected by Or83a may relate to food sources, oviposition sites, or predator avoidance

    • The receptor's sensitivity and specificity likely evolved in response to selection pressures in the natural environment

    • Comparative studies with closely related Drosophila species that occupy different ecological niches could reveal how Or83a has adapted to specific environmental challenges

  • System Redundancy and Specialization:

    • The OR family shows evidence of both specialization and redundancy, with some receptors narrowly tuned to specific compounds and others responding to broader classes of chemicals

    • Or83a's position within this spectrum reflects evolutionary trade-offs between specific detection capabilities and system robustness

Understanding the evolutionary significance of Or83a requires integrating molecular function with ecological context, highlighting the importance of interdisciplinary approaches in olfactory receptor research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.