Recombinant Drosophila melanogaster Putative odorant receptor 85b (Or85b)

Shipped with Ice Packs
In Stock

Description

Functional Role in Odorant Detection

Or85b forms a ligand-gated ion channel complex with the co-receptor OR83b, enabling responses to odorants like 2-heptanone and esters . Key mechanistic insights include:

  • Transmembrane Segment 3 (TMS3): Residues 142–150 at the TMS3–extracellular loop 2 (ECL2) interface are critical for odorant activation .

  • Antagonist Binding: The competitive antagonist 2-nonanone protects residue C148 from modification, localizing this region near the odorant-binding site .

  • Sensitivity Modulation: Mutations at positions 142 (I142A) and 143 (V143A) alter receptor sensitivity to 2-heptanone .

Research Applications

Recombinant Or85b is utilized in:

  • Odorant Response Profiling: Functional assays in Xenopus oocytes or Drosophila neurons to map ligand specificity .

  • Structural Modeling: Coevolution-based predictions of 3D architecture to identify odorant-binding domains .

  • Population Genetics: QTL mapping to study sensory neuron expansion in Drosophila species .

Key Findings from Studies

Study FocusMethodologyOutcomeSource
Odorant ActivationSubstituted cysteine accessibilityIdentified TMS3–ECL2 interface as critical for 2-heptanone response
Neuron ExpansionQTL mapping in D. sechelliaChromosomes 3 and X linked to Or85b neuron population differences
Receptor CoevolutionAmino acid coevolution analysisPredicted EL2 and TMH7 as structurally constrained regions

Technical Considerations

  • Co-receptor Dependency: Functional assays require co-expression with OR83b for ion channel activity .

  • Storage Stability: Repeated freeze-thaw cycles degrade activity; glycerol supplementation (5–50%) improves longevity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Or85b; CG11735; Odorant receptor 85b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or85b
Target Protein Sequence
MEKLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFM DNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMY LGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNW SYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRF LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFL VSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKAT IFLDITRSTMTDLLQISYKFFALLRTMYTQ
Uniprot No.

Target Background

Function
Odorant receptor mediating acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire comprises a wide range of odor stimuli varying in identity, intensity, and duration. It forms a complex with Orco to create odorant-sensing units, facilitating sensitive and prolonged odorant signaling and calcium permeability. Involved in behavioral responses to 2-heptanone, amyl acetate, and butyl acetate.
Gene References Into Functions
  1. Using the substituted cysteine accessibility method, residues 146-150 of OR85b, located at the predicted interface between transmembrane segment 3 and extracellular loop 2, were identified as playing a role in odorant (2-heptanone) activation. PMID: 20147286
Database Links

KEGG: dme:Dmel_CG11735

STRING: 7227.FBpp0081383

UniGene: Dm.23308

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is Drosophila melanogaster Or85b and what is its role in olfaction?

Or85b is a putative odorant receptor protein expressed in Drosophila melanogaster olfactory sensory neurons (OSNs). The full-length protein consists of 390 amino acids and is produced as a recombinant protein in E. coli expression systems with a His-tag for purification purposes . It functions as part of the olfactory system, allowing fruit flies to detect specific chemical compounds in their environment. Or85b is expressed in ab3 sensillum-housed neurons, which form part of the antenna's chemosensory apparatus .

What is the molecular structure and classification of Or85b?

The Or85b protein belongs to the odorant receptor family in Drosophila. Below is the product information for the recombinant protein:

Cat.#Product nameSource (Host)SpeciesTagProtein Length
RFL11293DFRecombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 85B(Or85B) ProteinE.coliDrosophila melanogaster (Fruit fly)HisFull Length (1-390)

Or85b is expressed in specific olfactory neurons in the ab3 sensilla of the Drosophila antenna. These neurons detect and transduce chemical signals from the environment, contributing to odor-guided behaviors like food finding, mate selection, and predator avoidance.

How can fluorescent reporter systems be used to study Or85b expression patterns?

Fluorescent reporter systems have been successfully implemented to visualize and quantify Or85b neuron populations. Researchers have generated specific fluorescent reporters of Or85b neurons in D. sechellia and D. simulans for high-throughput quantification studies . These reporter systems allow for comparative analysis of Or85b expression between different Drosophila species and their hybrids. By using these fluorescent markers, researchers were able to phenotype over 600 F2 individuals in genetic mapping experiments, providing quantitative data on Or85b neuron numbers .

What methodology should be followed for generating Or85b transgenic flies?

The generation of Or85b transgenic flies involves a systematic approach using CRISPR/Cas9-mediated genome engineering. The procedure includes:

  • Design and construction of sgRNA expression vectors targeting the Or85b locus, using annealed oligonucleotide pairs cloned into vectors like pCFD3-dU6-3gRNA .

  • Preparation of donor vectors for homologous recombination by amplifying homology arms (1-1.6 kb) for the Or85b locus from genomic DNA and inserting them into vectors such as pHD-DsRed-attP or pHD-Stinger-attP via restriction cloning or Gibson Assembly .

  • Microinjection of a mix containing the sgRNA-encoding construct (150 ng μl-1) and donor vector (500 ng μl-1) into embryos expressing Cas9 (such as D. sechellia nos-Cas9) .

  • Screening for successful transformants using fluorescent markers or other phenotypic indicators.

  • Verification of gene modification through PCR and sequencing.

This methodological approach enables precise genetic manipulation of the Or85b locus for functional studies.

How have QTL mapping approaches revealed the genetic basis of Or85b neuron population differences?

Quantitative Trait Locus (QTL) mapping has identified specific genomic regions associated with variation in Or85b neuron numbers between Drosophila species. By phenotyping and genotyping over 600 F2 individuals (backcrossed to either D. sechellia or D. simulans), researchers identified two key genomic regions linked to Or85b neuron number variation :

  • A QTL on chromosome 3 explaining a difference of approximately 12 neurons between species (effect size 21.0%).

  • A QTL on chromosome X explaining a difference of approximately 7 neurons between species (effect size 12.3%).

No significant epistasis was detected between these genomic regions, suggesting they contribute additively to the phenotype . The relatively low effect sizes indicate that more than two loci likely contribute to the species difference in Or85b neuron number, pointing to a complex genetic architecture underlying this trait.

What experimental approaches can validate QTL findings for Or85b neuron development?

Introgression experiments provide a powerful approach to validate QTL findings. Researchers have successfully introgressed fragments of the D. sechellia genomic region spanning the chromosome 3 QTL peak into a D. simulans background, which led to increased numbers of Or85b neurons, confirming the QTL mapping results . Interestingly, the phenotypic effect was lost with smaller introgressed regions, indicating that multiple loci within this QTL region influence Or85b neuron number . This finding highlights the complex genetic architecture underlying species differences in olfactory neuron populations and demonstrates how introgression studies can complement QTL mapping to pinpoint causative genetic regions.

How do Or85b neuron populations differ between Drosophila species?

Significant differences in Or85b neuron numbers exist between different Drosophila species. Research has shown that D. sechellia and D. simulans exhibit distinct numbers of Or85b neurons, with interspecific F1 hybrids displaying an intermediate number compared to the parental strains . These differences in Or85b neuron population size appear to be genetically determined, with multiple loci contributing to the variation. The expansion of Or85b neuron populations in certain species may enhance their ability to detect specific odorants, potentially conferring evolutionary advantages in finding food resources or avoiding predators.

How can the DoOR database be utilized to study Or85b function in the context of the Drosophila olfactome?

The DoOR (Drosophila Odorant Response) database provides a comprehensive resource for studying odorant receptor function. While Or85b is not specifically highlighted in relation to this database in the search results, the database contains response data for 78 responding units across 693 odorants, totaling 7381 data points . Researchers can use this resource to:

  • Compare Or85b response profiles with other odorant receptors

  • Identify potential ligands for Or85b

  • Place Or85b function in the broader context of the Drosophila olfactory system

The DoOR web interface (http://neuro.uni.kn/DoOR) provides easy access to these data, with approximately 140 unique web sessions per month from about 50 countries as of 2014 . Additionally, the downloadable R toolbox allows for more sophisticated data analysis and visualization.

What CRISPR/Cas9 strategies are most effective for Or85b locus modification?

Effective CRISPR/Cas9 modification of the Or85b locus requires careful design of targeting components and selection of appropriate vectors. Based on methodologies described in the research literature, the following approach is recommended:

For sgRNA expression:

  • Single sgRNAs targeting the Or85b locus can be designed using annealed oligonucleotide pairs cloned into pCFD3-dU6-3gRNA vector .

  • For multiple sgRNAs, the pCFD5 vector system can be employed using Gibson Assembly .

For homologous recombination:

  • Homology arms (1-1.6 kb) for the Or85b locus should be amplified from the appropriate species' genomic DNA and inserted into vectors like pHD-DsRed-attP or pHD-Stinger-attP .

The injection mixture should contain sgRNA-encoding construct (150 ng μl-1) and donor vector (500 ng μl-1) for optimal results when injected into Cas9-expressing embryos . This methodology enables precise genetic manipulation of the Or85b locus for functional studies.

What expression systems are optimal for producing functional recombinant Or85b protein?

While the search results indicate that recombinant Or85b has been successfully expressed in E. coli with a His-tag , optimal expression of functional membrane proteins like odorant receptors often requires careful consideration of expression systems. Bacterial systems like E. coli offer high yield but may struggle with proper folding of complex membrane proteins. For functional studies, researchers might consider:

  • Insect cell expression systems (e.g., Sf9, S2) which provide a more native-like environment for Drosophila proteins

  • Cell-free expression systems that can directly incorporate the protein into artificial membranes or nanodiscs

  • Mammalian expression systems for studies requiring complex post-translational modifications

The choice depends on the specific research goals, whether structural studies requiring high yields or functional assays requiring proper protein folding and membrane insertion.

What electrophysiological techniques can be used to study Or85b function?

Single sensillum recording (SSR) represents a powerful electrophysiological technique for studying odorant receptor function in Drosophila. While not specifically mentioned for Or85b in the search results, this technique has been successfully applied to other odorant receptors like Or56a . For studying Or85b, researchers would identify and record from ab3 sensilla where Or85b is expressed. The basic methodology involves:

  • Immobilizing flies and accessing antennal sensilla

  • Inserting a glass microelectrode into the base of an identified sensillum

  • Recording neuronal activity in response to odorant stimulation

  • Analyzing spike frequency and patterns to characterize receptor responses

This approach allows for direct measurement of Or85b-expressing neuron responses to different odorants, providing insights into the receptor's tuning properties and role in olfactory coding.

How can calcium imaging be used to analyze Or85b-mediated responses?

Calcium imaging provides a powerful approach for visualizing and quantifying neuronal activity in response to odorants. The search results indicate that calcium imaging has been used to record response profiles of olfactory sensory neurons in Drosophila . For analyzing Or85b-mediated responses, researchers would:

  • Express calcium indicators (e.g., GCaMP) in Or85b-expressing neurons using the GAL4-UAS system

  • Prepare antenna or brain samples for imaging while maintaining their viability

  • Deliver controlled odorant stimuli while recording fluorescence changes

  • Analyze the temporal and spatial patterns of calcium signals to characterize response properties

This methodology allows for high-throughput screening of potential Or85b ligands and characterization of response dynamics, complementing electrophysiological approaches.

How does Or85b neuron population expansion affect odor tracking behavior?

Research suggests that expansion of sensory neuron populations, including Or85b neurons, enhances odor tracking capabilities in Drosophila . The difference in Or85b neuron numbers between species like D. sechellia and D. simulans likely contributes to species-specific olfactory behaviors. The genetic mapping of factors controlling Or85b neuron numbers provides a foundation for investigating how these differences influence behavioral outcomes. Future research might use optogenetic or thermogenetic manipulation of Or85b neurons to directly test how neuron population size affects sensitivity thresholds and tracking precision for specific odorants.

What are the implications of Or85b research for understanding general principles of olfactory system evolution?

Research on Or85b neuron population differences between closely related Drosophila species provides valuable insights into olfactory system evolution. The findings that multiple genetic loci contribute to these differences, with QTLs on both chromosomes 3 and X, suggest a complex evolutionary history involving multiple genetic changes . This research reveals how sensory systems can be modified through evolution to adapt to specific ecological niches. Furthermore, the methodology combining genetic mapping, CRISPR/Cas9 engineering, and neurophysiological techniques established for Or85b research provides a template for investigating evolutionary changes in other sensory systems.

How does Or85b function compare to other odorant receptors in Drosophila?

Comparing Or85b with other Drosophila odorant receptors provides context for understanding its specific role in the olfactory system. The DoOR database, which integrates odorant response data for multiple receptors including Or10a, Or42b, Or47b, and Or56a, offers a platform for such comparisons . While specific comparative data for Or85b is not provided in the search results, the methodological approach of using databases like DoOR allows researchers to:

  • Compare response profiles across receptors to identify similarities and differences

  • Cluster receptors based on response patterns to understand functional organization

  • Identify cases of convergent or divergent evolution in receptor tuning properties

Such comparative analyses contribute to our understanding of how the olfactory system encodes and processes odor information.

What resources and databases are available for Or85b researchers?

Several resources are available for researchers studying Or85b:

  • The DoOR (Drosophila Odorant Response) database (http://neuro.uni.kn/DoOR) provides comprehensive odorant response data for Drosophila olfactory neurons and receptors, with 693 odorants and 7381 data points across 78 responding units . While not specifically mentioned for Or85b, this database likely contains relevant information.

  • Commercial sources like Creative BioMart offer recombinant Or85b protein for biochemical studies .

  • Genetic resources including fluorescent reporter lines for Or85b neurons in different Drosophila species have been developed .

  • Methodologies for CRISPR/Cas9-mediated genome engineering of the Or85b locus have been established and published .

These resources facilitate research across multiple aspects of Or85b biology, from molecular function to evolutionary significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.