Recombinant Drosophila melanogaster Putative odorant receptor 85c (Or85c)

What is Drosophila melanogaster Putative odorant receptor 85c (Or85c)?

Or85c is one of the 62 odorant receptors (ORs) identified in Drosophila melanogaster. It belongs to a family of insect chemosensory receptors that function in olfactory sensory neurons (OSNs) to detect odor molecules. Or85c (also known as CG17911) is a full-length protein consisting of 389 amino acids that functions as a putative odorant receptor involved in the detection of specific chemical cues in the fly's environment . Unlike mammalian G protein-coupled receptors (GPCRs), Drosophila ORs exhibit an inverted membrane topology with intracellular N-termini, representing an insect-specific solution for odor recognition .

How does the structure of Or85c compare to other Drosophila odorant receptors?

The typical Drosophila OR, including Or85c, has multiple transmembrane domains that adopt an atypical membrane topology compared to vertebrate ORs. In contrast to mammalian ORs which are GPCRs with extracellular N-termini, Drosophila Or85c and other insect ORs have their N-termini and the most conserved loops located intracellularly . This inverted topology is critical for their function, as these cytoplasmic domains mediate the direct association with the co-receptor OR83b (now known as Orco), forming a heteromeric complex essential for olfactory function . The amino acid sequence of Or85c (MKFMKYAVFFYTSVGIEPYTIDSRSKKASLWSHLLFWANVINLSVIVFGEILYLGVAYSD GKFIDAVTVLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEMYRLDRYL RSCSRISITYALLYSVLIWTFNLFSIMQFLVYEKLLKIRVVGQTLPYLMYFPWNWHENWT YYVLLFCQNFAGHTSASGQISTDLLLCAVATQVVMHFDYLARVVEKQVLDRDWSENSRFL AKTVQYHQRILRLMDVLNDIFGIPLLLNFMVSTFVICFVGFQMTVGVPPDIMIKLFLFLF SSLSQVYLICHYGQLIADASSSLSISAYKQNWQNADIRYRRALVFFIARPQRTTYLKATI FMNITRATMTDLLQVSYKFFALLRTMYIK) contains regions that are important for membrane insertion, ligand binding, and interaction with OR83b .

What is the relationship between Or85c and the co-receptor OR83b (Orco)?

Or85c, like other conventional Drosophila ORs, does not function independently but requires heterodimerization with OR83b (Orco), a highly conserved and broadly expressed co-receptor present in approximately 70-80% of antennal OSNs . This heterodimeric relationship is essential for several functions:

• Trafficking: OR83b couples the OR/OR83b complex to the conserved ciliary trafficking pathway

• Stabilization: OR83b is essential to maintain the OR/OR83b complex within sensory cilia, where odor signal transduction occurs

• Functional expression: The OR/OR83b complex is necessary and sufficient for odor-evoked signaling

The heterodimerization process occurs early in the endomembrane system in OSNs, with the cytoplasmic loops of the conventional OR (such as Or85c) mediating direct association with OR83b . This atypical heteromeric design is an insect-specific solution for odor recognition and represents a potential target for selective insect repellent development.

Where and when is Or85c expressed in Drosophila melanogaster?

Or85c is expressed in specific subpopulations of olfactory sensory neurons (OSNs) located in the third segment of the Drosophila antenna, which serves as the major olfactory organ containing approximately 1,200 OSNs . The antenna's surface is covered with porous sensory hairs (sensilla) of three major morphological classes (basiconic, coeloconic, and trichoid), which house the dendrites of OSNs . Or85c expression begins during development and continues into adulthood, with significant post-eclosion changes in expression patterns and response properties .

The OSN dendrites comprise a proximal inner segment and a distal-ciliated outer segment, with Or85c/OR83b complexes localized to the ciliated outer segments where odor detection occurs . The specific sensilla type (likely type II based on the research context) housing Or85c-expressing neurons can be identified through electrophysiological recordings and response profiling .

How can researchers effectively study the subcellular localization of Or85c?

Researchers can employ several complementary approaches to study Or85c subcellular localization:

• Immunohistochemistry with epitope-tagged Or85c: Utilizing the recombinant His-tagged Or85c protein allows for antibody-based detection in fixed tissue . This approach can be combined with markers for subcellular compartments (ER, Golgi, cilia) to track the protein throughout the secretory and trafficking pathways.

• Live imaging with fluorescently tagged Or85c: Creating fusion proteins with GFP or other fluorescent proteins enables real-time visualization of trafficking and localization.

• Electron microscopy: For ultrastructural localization, immunogold labeling can provide nanometer-scale resolution of Or85c positioning within membrane domains.

• Biochemical fractionation: Membrane fractionation followed by Western blotting can quantitatively assess the distribution of Or85c across different cellular compartments.

• Co-localization studies: Dual labeling of Or85c with OR83b can reveal the dynamics of heterodimer formation and trafficking.

The choice of approach depends on the specific research question, with combinations of methods providing the most comprehensive understanding of localization dynamics.

What are the recommended methods for expressing and purifying recombinant Or85c protein?

Based on the available data, recombinant Or85c can be successfully expressed and purified using the following protocol:

• Expression system: E. coli represents a viable heterologous expression system for producing full-length Or85c (1-389aa) . The protein should be expressed with an N-terminal His-tag to facilitate purification.

• Purification strategy:

  • Use affinity chromatography with Ni-NTA or similar matrices to capture the His-tagged protein

  • Implement appropriate buffer conditions to maintain protein stability

  • Consider detergent selection carefully, as membrane proteins require specific detergents for solubilization and stability

• Post-purification processing:

  • The protein can be prepared as a lyophilized powder for long-term storage

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage at -20°C/-80°C

• Quality control:

  • Assess purity using SDS-PAGE (should be >90%)

  • Verify identity via mass spectrometry or Western blotting

  • Evaluate functional integrity through ligand-binding assays

• Storage considerations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

How can researchers design effective functional assays for Or85c?

To assess Or85c function, researchers can implement several complementary approaches:

What methodology is recommended for investigating odor response profiles of Or85c-expressing neurons?

To comprehensively characterize the odor response profiles of Or85c-expressing neurons, researchers should implement a systematic methodology:

• Odor panel selection:

  • Test a diverse panel of ecologically relevant odorants at multiple concentrations

  • Include chemical series (homologous compounds with systematic structural variations) to probe structure-activity relationships

  • Use proper dilution controls (paraffin oil or water) as reference

• Stimulus delivery optimization:

  • Standardize odor cartridge preparation and stimulus parameters

  • Implement precise timing and concentration control

  • Maintain consistent airflow and humidity conditions

• Response quantification metrics:

  • Record multiple parameters beyond simple spike frequency:

    • Latency to response

    • Response duration

    • Adaptation characteristics

    • Temporal dynamics of firing patterns

• Advanced analytical approaches:

  • Implement information-theoretic analysis to determine discriminative capacity

  • Accumulate the DJS over the response time course to determine cumulative information gain (ΣDjs)

  • Use bootstrap resampling to assess the robustness of information gain measures

• Comparative analysis:

  • Compare Or85c responses to those of other OR-expressing neurons

  • Assess the effect of developmental and experience-dependent plasticity

  • Examine differences in coding properties across environmental conditions

This comprehensive approach enables researchers to fully characterize the functional properties of Or85c-expressing neurons and place them within the broader context of the Drosophila olfactory system.

How does Or85c contribute to olfactory signal transduction in Drosophila?

Or85c functions as part of the heteromeric Or85c/OR83b complex in the olfactory signal transduction pathway of Drosophila. Unlike vertebrate ORs that signal through G-protein coupled pathways, the Drosophila Or85c/OR83b complex forms a ligand-gated ion channel with the following characteristics:

The atypical membrane topology of Or85c, with its N-terminus and conserved loops in the cytoplasm, plays a crucial role in this signal transduction mechanism by mediating the interaction with OR83b and potentially influencing channel properties .

How do environmental factors and experience affect Or85c-mediated olfactory responses?

Research demonstrates that Or85c-mediated olfactory responses undergo significant experience-dependent plasticity. This plasticity manifests in several ways:

• Post-eclosion modification: Olfactory responses undergo pronounced changes after eclosion (emergence from pupal case) based on odor exposure . These changes include:

  • Development of attraction to exposed odors

  • Development of aversion to certain other odors

  • Alterations in the firing pattern of OSNs

• Effects of specific odor exposure: Flies exposed to specific odorants (e.g., ethyl acetate) show:

  • Increased sensitivity to these odorants

  • Modified concentration-response relationships

  • Changes in temporal response dynamics

• Impact of complex odor environments: Flies exposed to complex odor environments (e.g., cornmeal medium) develop:

  • Greater capacity to distinguish between different odors

  • More varied sensitivity to specific odorants

  • Enhanced discriminative power at the receptor neuron level

• Consequences of odor deprivation: Flies deprived of odor experience on odorless synthetic medium exhibit:

  • Loss of sensitivity to odorants

  • Reduced acuity in distinguishing between odors

  • Altered temporal response properties

The mechanism underlying this plasticity involves changes in the firing pattern of Or85c-expressing ORNs, which can be quantitatively assessed using information-theoretic measures like Jensen-Shannon divergence . The accumulation of divergence over time (ΣDjs) reveals how odor experience shapes both the sensitivity and discriminative capacity of these neurons.

Table 1: Effects of Different Rearing Conditions on Or85c-expressing Neuron Properties

Note: Data derived from information in source . Ratio values represent the ratio of information gain for the most divergent dilution to the average information gain for all dilutions.

How can Or85c be used in structure-function relationship studies of insect odorant receptors?

Or85c offers a valuable model for structure-function studies of insect odorant receptors due to its well-characterized properties and the availability of recombinant expression systems. Researchers can employ the following approaches:

• Mutagenesis studies:

  • Targeted mutations can be introduced to identify critical residues for:

    • Ligand binding

    • OR83b interaction

    • Channel gating

    • Membrane topology maintenance

  • The complete amino acid sequence of Or85c (provided in source ) allows for rational design of mutations

• Domain swapping experiments:

  • Chimeric receptors combining domains from Or85c and other ORs can reveal:

    • Regions determining odor specificity

    • Domains essential for OR83b interaction

    • Sequences required for proper trafficking

• Structure prediction and validation:

  • Computational models based on the Or85c sequence can predict structural features

  • These predictions can be tested experimentally using:

    • Accessibility studies (cysteine scanning)

    • Cross-linking approaches

    • Spectroscopic methods

• Functional correlation:

  • Structural modifications can be directly linked to functional outcomes using:

    • Electrophysiological recordings from OSNs

    • Heterologous expression systems

    • Information-theoretic analysis of response properties

• Comparative analysis:

  • Alignment of Or85c with other Drosophila ORs and ORs from other insect species can:

    • Identify conserved motifs

    • Reveal evolutionary constraints

    • Highlight species-specific adaptations

These approaches will contribute to understanding the unique structural and functional properties of insect odorant receptors, including their atypical membrane topology and heteromeric organization with the co-receptor OR83b.

What are the current challenges in studying Or85c and how might they be addressed?

Research on Or85c faces several significant challenges that require innovative approaches:

• Membrane protein expression and purification:

  • Challenge: Like many membrane proteins, Or85c can be difficult to express and purify in functional form

  • Solutions:

    • Optimize expression systems (bacterial, insect cells, cell-free)

    • Explore fusion partners to enhance solubility

    • Implement reconstitution into nanodiscs or liposomes

    • Use detergent screening to identify optimal solubilization conditions

• Structural characterization:

  • Challenge: Obtaining high-resolution structural data for membrane proteins like Or85c is technically demanding

  • Solutions:

    • Apply cryo-electron microscopy to the Or85c/OR83b complex

    • Utilize X-ray crystallography with stabilizing antibody fragments

    • Implement advanced NMR techniques for dynamic studies

    • Combine computational modeling with experimental validation

• Functional reconstitution:

  • Challenge: Recreating the native functional environment of Or85c is complex

  • Solutions:

    • Co-express Or85c with OR83b in heterologous systems

    • Develop cell-free platforms with defined lipid composition

    • Create artificial membrane systems mimicking ciliary membranes

    • Apply high-throughput functional assays to screen conditions

• Analysis of temporal dynamics:

  • Challenge: Capturing the complex temporal patterns of Or85c-mediated responses

  • Solutions:

    • Implement information-theoretic approaches like Jensen-Shannon divergence

    • Apply advanced signal processing algorithms to extract temporal features

    • Develop machine learning approaches to identify response patterns

    • Use dimensionality reduction techniques (e.g., ISOMAP) to visualize response relationships

• Understanding experience-dependent plasticity:

  • Challenge: Elucidating mechanisms underlying odor experience-dependent changes

  • Solutions:

    • Conduct controlled odor exposure experiments across development

    • Apply genetic tools to manipulate activity in Or85c neurons

    • Combine electrophysiology with functional imaging

    • Implement computational models of plasticity

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biophysics, computational methods, and systems neuroscience.

How can Or85c research contribute to the development of novel insect control strategies?

Research on Or85c and other insect odorant receptors has significant translational potential for insect control strategies:

• Target identification for repellent development:

  • The unique heteromeric structure and topology of insect ORs (Or85c/OR83b complex) represents an insect-specific target

  • This atypical design could be exploited to develop highly selective insect repellents

  • Targeting the Or85c/OR83b interface could disrupt olfactory-mediated host-seeking behaviors

• Structure-based antagonist design:

  • Knowledge of Or85c structure-function relationships enables rational design of:

    • Competitive antagonists that block odor binding

    • Allosteric modulators that alter receptor conformation

    • Disruptors of Or85c/OR83b complex formation

• Functional screening platforms:

  • Recombinant Or85c expression systems provide platforms for:

    • High-throughput screening of compound libraries

    • Structure-activity relationship studies

    • Validation of computer-designed molecules

• Behavioral disruption strategies:

  • Understanding Or85c-mediated behavioral responses allows development of:

    • Odor-baited traps utilizing Or85c ligands

    • Masking compounds that interfere with Or85c activation

    • Spatial repellents that overstimulate Or85c pathways

• Ecological risk assessment:

  • Comparative studies of Or85c across insect species inform:

    • Species selectivity of potential compounds

    • Ecological safety profiles of interventions

    • Non-target effects on beneficial insects

This research direction is particularly relevant for controlling disease vectors, as disrupting olfactory-mediated host-seeking behaviors could reduce disease transmission while minimizing environmental impact compared to conventional insecticides.

What are the most promising future research directions for Or85c studies?

Several high-priority research directions for Or85c will likely yield significant advances in understanding insect olfaction:

• High-resolution structural studies:

  • Determining the atomic structure of Or85c alone and in complex with OR83b

  • Capturing different conformational states (resting, activated, desensitized)

  • Resolving ligand-binding sites and channel pores

• Systems-level integration:

  • Mapping the complete neural circuit initiated by Or85c-expressing neurons

  • Understanding how Or85c signals are processed at higher brain centers

  • Elucidating how Or85c contributes to behavioral output in various contexts

• Molecular mechanisms of plasticity:

  • Identifying molecular changes underlying experience-dependent adaptation

  • Characterizing epigenetic and transcriptional regulation of Or85c expression

  • Determining how neuronal activity shapes Or85c-mediated signaling

• Comparative and evolutionary studies:

  • Analyzing Or85c orthologs across insect species

  • Reconstructing the evolutionary history of the unique insect OR architecture

  • Understanding how natural selection has shaped Or85c function in different ecological niches

• Translational applications:

  • Developing Or85c-based biosensors for odor detection

  • Creating high-throughput screening platforms for insect repellent discovery

  • Engineering modified Or85c variants with novel properties

These research directions will not only advance our understanding of insect olfaction but may also lead to innovations in fields ranging from sensory neurobiology to insect control and biosensor technology.

How can computational approaches enhance Or85c research?

Computational methods offer powerful tools to address complex questions in Or85c research:

• Structural modeling and simulation:

  • Homology modeling and ab initio structure prediction

  • Molecular dynamics simulations of Or85c in membrane environments

  • Docking studies to identify potential ligands and binding sites

  • Prediction of conformational changes during activation

• Systems biology approaches:

  • Network modeling of olfactory circuits involving Or85c

  • In silico testing of hypotheses about signal integration

  • Prediction of emergent properties from molecular-level details

• Information-theoretic analysis:

  • Advanced methods to quantify information content in Or85c-mediated responses

  • Application of Jensen-Shannon divergence and related measures to assess:

    • Odor discrimination capacity

    • Concentration coding precision

    • Temporal coding properties

  • Implementation of dimensionality reduction techniques (e.g., ISOMAP) to visualize complex response relationships

• Machine learning applications:

  • Development of algorithms to:

    • Predict Or85c ligands based on molecular structure

    • Classify response patterns from electrophysiological recordings

    • Identify structure-function relationships from mutagenesis data

• Evolutionary computations:

  • Phylogenetic analysis of Or85c and related receptors

  • Detection of selection signatures in OR sequences

  • Reconstruction of ancestral OR sequences and functions

These computational approaches complement experimental methods and can accelerate discovery by generating testable hypotheses, interpreting complex datasets, and revealing patterns not immediately apparent from experimental data alone.

What are the key technical innovations needed to advance Or85c research?

Several technical innovations would significantly accelerate progress in Or85c research:

• Improved membrane protein expression systems:

  • Development of specialized expression vectors optimized for insect ORs

  • Creation of fusion partners that enhance folding and stability

  • Engineering of host cells with insect-specific chaperones and lipid composition

• Advanced imaging technologies:

  • Super-resolution microscopy techniques to visualize Or85c distribution in OSN dendrites

  • Voltage imaging with improved temporal resolution to capture fast signaling events

  • Correlative light-electron microscopy to link function with ultrastructure

• Single-molecule analysis methods:

  • Techniques to study individual Or85c/OR83b complexes:

    • Single-molecule FRET to capture conformational dynamics

    • Single-channel recordings to characterize channel properties

    • Single-particle tracking to monitor receptor movement in membranes

• High-throughput functional screening platforms:

  • Automated electrophysiology systems for rapid compound testing

  • Cell-based assays compatible with large-scale screening

  • Microfluidic devices for precise stimulus delivery and response measurement

• Genetic tools for precise manipulation:

  • Development of Or85c promoter-driven expression systems

  • Creation of conditional knock-in/knock-out strategies

  • Implementation of optogenetic and chemogenetic tools in Or85c-expressing neurons

• Computational infrastructure:

  • Specialized software for analyzing complex electrophysiological data

  • Pipelines for implementing information-theoretic approaches

  • High-performance computing resources for molecular simulations and structural modeling

These technical innovations would address current bottlenecks in Or85c research and enable new experimental approaches that could yield fundamental insights into insect olfaction and receptor function.

How can researchers optimize experimental design when working with recombinant Or85c?

Researchers working with recombinant Or85c should consider several factors to optimize experimental design:

• Expression system selection:

  • E. coli systems are effective for producing full-length His-tagged Or85c

  • Consider insect cell systems for studies requiring post-translational modifications

  • Evaluate cell-free systems for rapid production and direct incorporation into membranes

• Protein handling optimization:

  • Store as lyophilized powder for long-term stability

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol before aliquoting for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

• Functional assay considerations:

  • Co-express with OR83b for functional studies

  • Include proper controls for each experimental variable

  • Standardize odor delivery methods using precise quantities (50 μl odorant solution on Whatman discs)

  • Deliver stimuli in controlled airflow (2 l/min) with precisely timed odor pulses (0.5 s at 0.5 l/min)

• Data analysis approaches:

  • Move beyond simple spike counting to information-theoretic measures

  • Apply Jensen-Shannon divergence to quantify response differences

  • Use bootstrap resampling to assess the robustness of measurements

  • Implement dimensionality reduction techniques to visualize complex relationships

• Experimental variables to control:

  • Age of flies (post-eclosion changes significantly affect responses)

  • Prior odor exposure (affects sensitivity and discrimination)

  • Environmental conditions during testing

  • Genetic background of experimental animals

By addressing these considerations, researchers can enhance the rigor and reproducibility of Or85c studies, facilitating meaningful comparisons across laboratories and experimental conditions.

How might Or85c research contribute to broader understanding of sensory systems?

Or85c research has implications that extend beyond insect olfaction to enhance our understanding of sensory systems generally:

• Alternative receptor architectures: The unique topology and heteromeric organization of Or85c challenges traditional models of chemosensory reception based on vertebrate GPCRs, revealing evolutionary diversity in molecular solutions for sensory detection .

• Experience-dependent sensory plasticity: The adaptive changes in Or85c-expressing neurons following odor exposure provide a tractable model for studying how experience shapes sensory systems at the cellular and molecular levels .

• Information encoding principles: Information-theoretic analysis of Or85c responses reveals general principles of sensory coding, including:

  • How temporal patterns enhance coding capacity

  • How experience shapes discriminative abilities

  • How sensory neurons balance sensitivity and specificity

• Translation of sensory input to behavior: Or85c research contributes to understanding the general principles by which sensory input is processed and translated into appropriate behavioral outputs .

• Evolution of sensory systems: Comparative studies of Or85c across species illuminate how ecological pressures shape sensory adaptations and how novel sensory mechanisms evolve.

• Model for studying membrane protein dynamics: Or85c provides a model system for investigating general principles of membrane protein trafficking, assembly, and function.