Recombinant Drosophila melanogaster Putative odorant receptor 85f (Or85f)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster Putative Odorant Receptor 85f (Or85f)

Recombinant Drosophila melanogaster Putative odorant receptor 85f (Or85f) is a ligand-gated ion channel protein belonging to the odorant receptor (OR) family. These receptors are critical for detecting volatile odorants in insects and are expressed in olfactory sensory neurons (OSNs). Or85f is part of the broader Drosophila OR gene family, which comprises 62 receptors divided into two subfamilies: odorant receptors (ORs) and ionotropic receptors (IRs) . The recombinant form of Or85f is engineered for functional studies, often expressed in heterologous systems (e.g., Xenopus oocytes or mammalian cells) to analyze its ligand specificity and signaling mechanisms .

Gene and Protein Structure

  • Genomic Location: Or85f is located on chromosome 2R in D. melanogaster .

  • Protein Length: The mature protein contains ~450 amino acids, with conserved transmembrane domains typical of ORs .

  • Homology: Or85f shares sequence homology with other Drosophila ORs (e.g., Or49a) and orthologs in related species like Rhagoletis suavis (RsOr1) .

FeatureOr85fRelated ORs
Chromosomal Location2RVaries (e.g., Or49a: 2R)
Protein Length~450 aa~400–500 aa
Homologous SpeciesRhagoletis suavis, AnophelesD. simulans, D. sechellia

Response Profiles

Or85f exhibits broad tuning to diverse odorants, as evidenced by single sensillum recordings and calcium imaging:

  • Broad Tuning: Or85f has a low lifetime kurtosis (LTK = 0.17), indicating activation by multiple odorants .

  • Ligand Diversity: While specific ligands remain understudied, population-level assays link Or85f polymorphisms to responses to benzaldehyde and acetophenone .

Odorant ClassExample LigandsResponse Type
AldehydesBenzaldehydeActivation
Ketones/EstersAcetophenoneActivation
Aromatic CompoundsPhenolic derivativesActivation/Specificity*

Note: Specific ligands for Or85f require further deorphanization studies.

Polymorphisms and Selection Pressures

Or85f exhibits genetic variation linked to olfactory behavior:

  • Signatures of Neutrality: Sequence analyses in D. melanogaster populations revealed deviations from neutrality for Or85f, suggesting functional constraint .

  • Linkage Disequilibrium: Polymorphisms in Or85f are associated with recombination events in female flies, influencing haplotype diversity .

Genetic ParameterOr85fComparison (Or42b)
Nucleotide Diversity (π)0.0014–0.01220.0014 (lower)
McDonald-Kreitman (MK)α = 0.54–0.75*α = 0.75 (positive selection)
α = fraction of substitutions fixed by positive selection.

Conservation and Functional Homology

Or85f shows conserved features across dipterans:

  • Homology to RsOr1: Rhagoletis suavis Or85f ortholog (RsOr1) shares 26–31% amino acid identity with D. melanogaster Or85f, clustering with Or49a in phylogenetic trees .

  • Co-Receptor Expression: Like Orco (the universal OR co-receptor), Or85f is co-expressed with ionotropic receptors (e.g., Ir25a) in antennal and maxillary palp neurons .

SpeciesOrthologAmino Acid Identity
D. melanogasterOr85f100% (reference)
Rhagoletis suavisRsOr126–31%
Anopheles coluzziiAGAP00191220–25%

Role in Olfactory Research

Or85f serves as a model for studying:

  1. Olfactory Plasticity: Polymorphisms in Or85f correlate with odorant-specific behavioral responses, implicating it in host preference adaptation .

  2. Receptor Co-Expression: Its overlap with Ir25a and other IRs suggests complex chemosensory integration in OSNs .

  3. Evolutionary Innovation: De novo gene birth and positive selection events in Or85f-related loci highlight mechanisms of olfactory diversification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Or85f; CG16755; Odorant receptor 85f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or85f
Target Protein Sequence
MEPVQYSYEDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGVCVGVMVFR MVEAKTIDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYH RVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDP VWIYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLHFRGIIRSLADHKPSVKHDQED RKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLEGFTYV IFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVEL NAMGYLSISLDTFKQLMSVSYRVITMLMQMIQ
Uniprot No.

Target Background

Function

Or85f is an odorant receptor in Drosophila melanogaster mediating acceptance or avoidance behaviors depending on the odorant substrate. The diverse repertoire of odorant receptors allows for the detection of a wide range of odor stimuli varying in identity, intensity, and duration. Or85f may interact with Orco to form functional odorant-sensing units, enabling sensitive and sustained odorant signaling and calcium permeability.

Database Links

KEGG: dme:Dmel_CG16755

STRING: 7227.FBpp0081506

UniGene: Dm.27246

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is the evolutionary significance of Or85f in Drosophila melanogaster?

Or85f shows significant signatures of deviations from neutrality in sequence analyses, suggesting it has been under selective pressure during evolution . Linkage disequilibrium analyses reveal a history of extensive recombination between polymorphic markers for Or85f and other odorant receptor genes. This evolutionary pattern likely reflects the critical role of Or85f in detecting compounds essential for survival, particularly those related to predator avoidance. When comparing across Drosophila species, Or85f exhibits relatively low sequence conservation despite maintaining similar functions, indicating that olfactory detection mechanisms can be preserved even with considerable sequence divergence .

In which neurons is Or85f expressed and what is its expression pattern?

Or85f is specifically expressed in the ab10B olfactory sensory neurons (OSNs) located in the antennae of adult Drosophila melanogaster . Importantly, this receptor is co-expressed with Or49a in the same neurons. Unlike many other odorant receptors, Or85f is not expressed in Drosophila larvae but only in adult flies . This developmental expression pattern suggests a life-stage specific function, possibly related to adult-specific behaviors such as mate finding or oviposition site selection. The expression of Or85f requires the presence of the odorant co-receptor Orco (Or83b), as studies with Orco mutants have shown reduced expression of many tuning receptors including Or85f .

What are the primary ligands detected by Or85f?

Or85f primarily responds to actinidine and nepetalactol, two iridoid compounds . These compounds are part of the chemical signature of certain parasitoid wasps such as Leptopilina boulardi, which are natural predators of Drosophila. Functional studies using gas chromatography coupled with single sensillum recording (GC-SSR) have demonstrated that the ab10B neurons expressing Or85f respond strongly to these specific compounds within the chemical profile of parasitoid wasps . This receptor-ligand interaction forms the molecular basis for the innate avoidance behavior that Drosophila exhibits toward these predators.

How does Or85f function in the context of the olfactory system?

Or85f functions as part of a heterodimeric complex with the co-receptor Or83b (Orco) . This complex forms ligand-gated nonselective cation channels in the dendritic membrane of olfactory sensory neurons . When activated by appropriate ligands such as actinidine or nepetalactol, these channels open, allowing cation influx that depolarizes the neuron and generates action potentials. The information is then relayed via projection neurons to higher brain centers, specifically to a posteriomedial domain in the lateral horn and the base of the mushroom body calyx that is associated with avoidance behaviors . This neural circuit organization explains how detection of parasitoid odors by Or85f ultimately leads to avoidance behavior.

What methodologies are most effective for functional characterization of recombinant Or85f?

For optimal functional characterization of recombinant Or85f, a multi-tiered approach is recommended:

  • Heterologous Expression Systems: Express Or85f together with Orco in Xenopus oocytes or HEK293 cells for electrophysiological recordings. This allows direct measurement of channel properties and ligand responses.

  • Single Sensillum Recording (SSR): For in vivo characterization, SSR remains the gold standard. Target the ab10 sensilla on the Drosophila antenna, distinguishing between ab10A and ab10B neurons using diagnostic odorants . When combined with gas chromatography (GC-SSR), this technique can identify active compounds within complex mixtures.

  • Calcium Imaging: Use genetically encoded calcium indicators (GECIs) under Or85f promoter control to visualize neuronal activation patterns in response to ligands. This approach can validate SSR findings and provide spatial information about receptor activation .

  • Computational Prediction: Implement machine learning approaches that utilize sequential-forward-selection (SFS) of molecular descriptors optimized for Or85f. Studies have shown that receptor-optimized descriptor sets can successfully predict novel ligands with approximately 71% accuracy . Focus on three-dimensional molecular descriptors, as these are particularly important for odorant receptor interactions.

How can genetic polymorphisms in Or85f be linked to behavioral phenotypes?

To establish connections between Or85f genetic variants and behavioral outcomes, follow this methodological framework:

  • Sequence Natural Variants: Obtain Or85f alleles from wild populations and inbred lines derived from natural populations. Sequence analysis should include both coding and regulatory regions to identify all relevant polymorphisms .

  • Quantitative Behavioral Assays: Use T-maze or trap assays to quantify behavioral responses to Or85f ligands across lines with different Or85f alleles. Ensure behavioral tests are conducted under standardized conditions with proper controls .

  • Statistical Association Analysis: Apply quantitative genetic approaches to identify significant associations between specific polymorphisms and behavioral variation. Fisher's exact test can be used to assess significance of associations .

  • Haplotype Analysis: Determine haplotypes using software such as SNAP to identify combinations of polymorphisms that may collectively influence receptor function .

  • Functional Validation: Generate transgenic flies expressing specific Or85f variants in an Or85f-null background to confirm causality between polymorphisms and behavioral phenotypes.

Studies have successfully identified polymorphisms in other odorant receptors (Or10a, Or43a, and Or67b) that significantly associate with variation in behavioral responses to odorants, demonstrating the feasibility of this approach .

What are the challenges in expressing functional recombinant Or85f in heterologous systems?

Several technical challenges must be addressed when expressing functional recombinant Or85f:

  • Co-receptor Dependency: Or85f requires co-expression with Orco (Or83b) to form functional channels. Both proteins must be correctly expressed and localized to the membrane .

  • Membrane Topology: Drosophila odorant receptors have an atypical membrane topology with a cytoplasmic N-terminus and an extracellular C-terminus, which differs from mammalian GPCRs. Expression systems must properly accommodate this inverted topology .

  • Post-translational Modifications: Ensure the expression system can provide appropriate post-translational modifications required for receptor function.

  • Functional Verification: Confirm that recombinant Or85f responds to known ligands (actinidine and nepetalactol) with similar sensitivity and specificity as the native receptor.

  • Receptor Stability: Optimize expression conditions to prevent receptor degradation or misfolding, particularly important for membrane proteins.

  • Interspecies Variation: Consider that Or85f has low sequence conservation across Drosophila species despite similar functions, which may complicate heterologous expression when using receptor sequences from different species .

How can computational approaches be used to predict novel ligands for Or85f?

Implementing computational prediction of novel Or85f ligands involves these key methodological steps:

  • Descriptor Optimization: Create a unique set of molecular descriptors specifically optimized for Or85f using Sequential-Forward-Selection methods. Research indicates a strong preference for three-dimensional and two-dimensional descriptors for odorant receptors, suggesting structural shape features are critical for receptor-odor interactions .

  • Training Set Development: Use known activators and non-activators of Or85f to train prediction models. The larger and more diverse this training set, the more accurate the predictions will be .

  • Cross-Validation: Perform five independent trials of fivefold cross-validations followed by Receiver-Operating-Characteristic analysis to validate the predictive ability of the model .

  • Chemical Space Screening: Screen large chemical databases (>240,000 potential volatiles) using the optimized descriptor set to identify candidate ligands .

  • Validation Testing: Experimentally test top candidates using electrophysiology or calcium imaging to verify predictions. Studies have shown approximately 71% success rates for similar computational approaches with other Drosophila odorant receptors .

This computational pipeline effectively bridges the gap between limited experimental data and comprehensive understanding of receptor-ligand interactions, enabling more efficient discovery of novel compounds that interact with Or85f.

What are the optimal conditions for expressing recombinant Or85f in Drosophila?

For optimal expression of recombinant Or85f in Drosophila, consider these methodological approaches:

  • GAL4-UAS System: Utilize the binary GAL4-UAS system with an appropriate driver like Orco-GAL4 to express UAS-Or85f in all olfactory neurons expressing Orco, or ab10B-specific drivers for targeted expression.

  • Age Considerations: Expression should be assessed in young adult flies (0-2 days post-eclosion) since receptor expression can change with age. Studies have shown progressive changes in receptor expression between 1, 7, and 20 days post-eclosion .

  • Sex Differences: Include both males and females in experimental designs, as some olfactory receptors show sex-specific expression patterns. Research protocols typically use approximately equal numbers of males and females .

  • Temperature Control: Maintain flies at 25°C during development, as temperature can affect GAL4-driven expression levels.

  • Verification Methods: Confirm expression using:

    • qRT-PCR to quantify mRNA levels

    • Immunohistochemistry with receptor-specific antibodies

    • Reporter constructs (e.g., GFP-tagged Or85f)

    • Functional validation via electrophysiological recordings from ab10B neurons

Research shows that expression of odorant receptors requires the presence of co-receptors, as demonstrated by decreased expression of many tuning receptors in Orco mutants, suggesting co-expression strategies are necessary .

How can one design experiments to study the role of Or85f in parasitoid avoidance behavior?

To investigate Or85f's role in parasitoid avoidance, implement this experimental framework:

  • Behavioral Assays:

    • T-maze Assays: Measure avoidance responses to parasitoid odors or purified actinidine/nepetalactol in wild-type vs. Or85f mutant flies.

    • Oviposition Choice Tests: Assess how Or85f affects egg-laying decisions when parasitoid cues are present .

    • Live Parasitoid Encounters: Observe behavioral responses when flies are exposed to parasitoid wasps in controlled environments.

  • Genetic Manipulations:

    • Generate Or85f null mutants using CRISPR/Cas9

    • Create Or85f-GAL4 driver lines for targeted neuronal manipulation

    • Use UAS-Kir2.1 or UAS-TeTxLC to silence ab10B neurons

    • Employ UAS-Or85f for rescue experiments in mutant backgrounds

  • Physiological Recordings:

    • Perform GC-SSR experiments with parasitoid headspace extracts and body washes

    • Compare responses between wild-type, Or85f mutants, and rescue lines

    • Consider that while Or85f responds to actinidine and nepetalactol, Or49a (co-expressed in ab10B) responds to iridomyrmecin, another parasitoid-associated compound

  • Controls and Considerations:

    • Test multiple parasitoid species (e.g., Leptopilina boulardi, L. heterotoma)

    • Include closely related Drosophila species to assess conservation of this defensive mechanism

    • Control for developmental effects by using conditional expression systems

Research has demonstrated that Drosophila species can detect parasitoid odors through ab10B neurons expressing Or49a and Or85f, leading to robust avoidance behavior that contributes to survival .

What techniques can be used to study the structural interactions between Or85f and its ligands?

To investigate structural interactions between Or85f and its ligands, employ these approaches:

  • Homology Modeling: Despite the lack of crystal structures for insect odorant receptors, create computational models based on proteins with similar structural features. Use these models to predict binding sites and interaction residues.

  • Site-Directed Mutagenesis: Systematically mutate key residues in Or85f predicted to be involved in ligand binding. Functional testing of these mutants can validate computational predictions and identify critical interaction points.

  • Chimeric Receptors: Create chimeric proteins between Or85f and closely related odorant receptors with different ligand specificities. This approach can identify domains responsible for ligand recognition.

  • Molecular Docking Simulations: Perform in silico docking of known ligands (actinidine and nepetalactol) to predicted receptor structures. Optimize using molecular dynamics simulations to account for conformational flexibility.

  • Structure-Activity Relationship Studies: Test a series of structural analogs of known ligands with systematic modifications to identify chemical features essential for receptor activation.

  • Molecular Descriptor Analysis: Research indicates that three-dimensional and two-dimensional descriptors are particularly important for odorant receptor interactions, suggesting shape features are critical for binding . Focus analysis on these parameters when studying Or85f-ligand interactions.

These approaches collectively provide insights into the structural basis of Or85f ligand specificity, which is essential for understanding how this receptor contributes to the detection of parasitoid odors and subsequent avoidance behaviors.

How should electrophysiological data from Or85f-expressing neurons be analyzed and interpreted?

For rigorous analysis of electrophysiological recordings from Or85f-expressing neurons:

  • Spike Sorting and Quantification:

    • Distinguish between ab10A and ab10B spikes based on amplitude differences

    • Quantify responses as spikes/second, normalized to pre-stimulus baseline

    • Calculate response latency and duration for temporal dynamics analysis

  • Dose-Response Analysis:

    • Test ligands across at least 5-6 log concentrations

    • Fit data to Hill equation to determine EC50 values and Hill coefficients

    • Compare potency and efficacy between different ligands

  • Statistical Approaches:

    • Use ANOVA with post-hoc tests for multiple comparisons

    • Apply non-parametric tests (e.g., Kruskal-Wallis) for non-normally distributed data

    • Include biological replicates from multiple flies and technical replicates

  • Physiological Context:

    • Compare responses between wild-type and mutant lines

    • Assess how co-expressed receptors (Or49a) might influence response profiles

    • Consider that response strength may vary with age of flies

  • Interpretation Considerations:

    • Strong responses (>100 spikes/s) generally indicate primary ligands

    • Inhibitory responses (below baseline) may have biological significance

    • Cross-compare with behavioral relevance of the compounds

GC-SSR studies have successfully used these approaches to identify actinidine and nepetalactol as ligands for Or85f, demonstrating these methods' effectiveness in characterizing receptor-ligand interactions .

What approaches can resolve contradictory findings about Or85f function across different studies?

When confronting contradictory research findings regarding Or85f function:

  • Methodological Reconciliation:

    • Compare experimental protocols in detail, including fly age, sex ratios, and environmental conditions

    • Consider that receptor expression changes with age, with significant differences observed between 1, 7, and 20 days post-eclosion

    • Evaluate differences in genetic backgrounds of Drosophila strains used

  • Genetic Variation Analysis:

    • Sequence Or85f from strains used in different studies to identify polymorphisms

    • Linkage disequilibrium analyses have shown extensive recombination between polymorphic markers

    • Assess whether specific polymorphisms correlate with functional differences

  • Ligand Presentation Differences:

    • Analyze how odorants were delivered (solvent, concentration, duration)

    • Consider potential interactions between multiple ligands when complex mixtures are used

    • Evaluate purity of compounds used across studies

  • Receptor Context Variation:

    • Assess expression system differences (heterologous vs. in vivo)

    • Consider co-receptor availability and expression levels

    • Evaluate the influence of other receptors co-expressed in the same neurons

  • Statistical Re-analysis:

    • Perform meta-analysis when appropriate

    • Consider whether statistical power was sufficient in conflicting studies

    • Evaluate whether different analytical approaches could explain discrepancies

Studies have shown that even closely related Drosophila species with low sequence conservation of Or85f can still detect similar parasitoid odors, suggesting functional conservation despite sequence variation that could contribute to apparently contradictory findings .

How can RNA-Seq data be used to analyze Or85f expression patterns and regulation?

For effective RNA-Seq analysis of Or85f expression:

  • Sample Preparation Protocol:

    • Dissect antennae from flies of specific ages (e.g., 0-2 DPE, 4-9 DPE, 16-20 DPE) with equal numbers of males and females

    • Prepare biological replicates (minimum three independent samples)

    • Include appropriate controls (wild-type and relevant mutants)

  • Sequencing and Alignment Considerations:

    • Use trimming tools like Sickle to generate clean reads

    • Align to reference genome using STAR with default parameters

    • Map reads uniquely to genes using HTSeq with "intersection-non-empty" and "non-unique-none" modes

  • Expression Analysis Approaches:

    • Calculate TPM/FPKM values for normalized expression

    • Perform differential expression analysis between conditions

    • Use specific software like DEXSeq for exon-by-exon analysis

  • Data Interpretation Framework:

    • Examine Or85f expression changes across different ages

    • Compare expression between wild-type and co-receptor mutants (e.g., Orco)

    • Correlate expression patterns with electrophysiological responses

    • Identify potential regulatory elements by examining co-expressed genes

  • Validation Methods:

    • Confirm key findings using qRT-PCR

    • Correlate with protein expression using immunohistochemistry

    • Validate functional implications using behavioral or electrophysiological assays

Research has demonstrated that RNA-Seq analysis can effectively track expression changes of odorant receptors, revealing that co-receptor mutants show decreased expression of many tuning receptors at the mRNA level .

How can cross-disciplinary approaches enhance Or85f research?

Integrating multiple disciplines can significantly advance Or85f research:

  • Computational Biology + Molecular Biology:

    • Implement machine learning approaches to predict novel Or85f ligands based on optimized descriptor sets

    • Use molecular modeling to identify key binding residues for experimental validation

    • Apply systems biology approaches to understand Or85f within the broader olfactory network

  • Evolutionary Biology + Functional Genomics:

    • Study Or85f sequence variation across Drosophila species in relation to ecological niches

    • Investigate signatures of selection and deviation from neutrality

    • Connect genotypic variation to functional differences in chemosensory abilities

  • Neuroscience + Behavioral Ecology:

    • Map neural circuits from Or85f-expressing neurons to higher brain centers

    • Correlate neuronal activation patterns with specific behavioral outputs

    • Study ecological contexts where Or85f-mediated detection provides selective advantages

  • Chemical Ecology + Synthetic Biology:

    • Identify natural sources of Or85f ligands in ecological settings

    • Develop synthetic compounds that selectively target Or85f

    • Engineer modified receptors with altered ligand specificities

  • Methodology Integration:

    • Combine electrophysiology, calcium imaging, and behavioral assays for comprehensive functional analysis

    • Utilize CRISPR/Cas9 genetic manipulation alongside classical genetic approaches

    • Apply high-throughput screening methods guided by computational predictions

These interdisciplinary approaches have proven successful in studies identifying the role of Or85f in parasitoid detection and in developing computational methods to predict receptor-ligand interactions .

What are the key considerations when comparing Or85f function across different Drosophila species?

When conducting comparative studies of Or85f across Drosophila species:

  • Sequence Homology Assessment:

    • Perform phylogenetic analysis of Or85f sequences across species

    • Identify conserved domains versus variable regions

    • Consider that Or85f exhibits relatively low sequence conservation despite functional similarities

  • Expression Pattern Comparison:

    • Determine whether Or85f is expressed in homologous neurons across species

    • Assess co-expression patterns with other receptors (e.g., Or49a)

    • Analyze developmental timing of expression

  • Functional Conservation Testing:

    • Conduct GC-SSR recordings from ab10-like sensilla across species

    • Compare responses to actinidine and nepetalactol

    • Assess behavioral responses to parasitoid odors

  • Ecological Context Evaluation:

    • Consider differences in parasitoid pressure across species' habitats

    • Assess whether response sensitivity correlates with ecological threat levels

    • Investigate potential divergent functions in species with different niches

  • Experimental Design Considerations:

    • Use consistent methodologies across species for valid comparisons

    • Include appropriate outgroups for evolutionary context

    • Control for phylogenetic relationships in statistical analyses

Research has demonstrated that despite sequence divergence, the behavioral avoidance of parasitoid odors is conserved across multiple Drosophila species, suggesting functional conservation of the underlying detection mechanism involving Or85f .

What emerging technologies could revolutionize Or85f research?

Several cutting-edge technologies promise to transform Or85f research:

  • Cryo-EM for Receptor Structure Determination:

    • Apply single-particle cryo-electron microscopy to resolve the structure of Or85f-Orco complexes

    • Determine structural changes upon ligand binding

    • Identify key interaction domains between Or85f and Orco

  • CRISPR-Based Technologies:

    • Use base editing for precise modification of specific amino acids

    • Apply CRISPR activation/inhibition systems for temporal control of Or85f expression

    • Implement CRISPR-mediated homology-directed repair for introducing reporter tags

  • Advanced Imaging Technologies:

    • Implement voltage imaging to visualize real-time activity in Or85f neurons

    • Use expansion microscopy for super-resolution imaging of receptor localization

    • Apply multimodal imaging to simultaneously track neural activity and behavior

  • Single-Cell Transcriptomics/Proteomics:

    • Profile gene expression in individual ab10B neurons

    • Identify co-regulated genes in Or85f-expressing cells

    • Discover novel factors involved in Or85f trafficking and function

  • AI-Enhanced Computational Approaches:

    • Develop advanced machine learning algorithms for improved ligand prediction

    • Create neural network models that incorporate three-dimensional receptor structure

    • Build comprehensive models integrating molecular dynamics with neural circuit activity

These technologies will enable researchers to address fundamental questions about Or85f structure, function, and evolution, potentially leading to applications in pest management and sensory system engineering.

How might research on Or85f contribute to broader understanding of olfactory coding principles?

Or85f research provides unique insights into olfactory coding:

  • Receptor-Ligand Specificity Mechanisms:

    • Or85f's specific responses to actinidine and nepetalactol help elucidate the molecular basis of odorant recognition

    • Understanding how structural features of ligands correlate with receptor activation, with research showing the importance of three-dimensional molecular descriptors

    • Investigating how receptor polymorphisms affect ligand specificity and sensitivity

  • Combinatorial Coding Principles:

    • Studying how co-expression of Or85f with Or49a in ab10B neurons contributes to detecting complex odor mixtures

    • Examining how information from multiple receptor types is integrated at higher brain centers

    • Understanding the functional significance of inhibitory responses versus activating responses

  • Neural Circuit Organization:

    • Mapping how Or85f-expressing neurons connect to specific domains in the lateral horn and mushroom body

    • Investigating how these circuits contribute to innate versus learned behaviors

    • Understanding how receptor-specific information is transformed across synaptic layers

  • Evolutionary Adaptability of Olfactory Systems:

    • Examining how Or85f function is maintained despite low sequence conservation

    • Investigating how receptor genes evolve in response to ecological pressures

    • Understanding the balance between specificity and adaptability in chemosensory systems

  • Translational Applications:

    • Applying principles from Or85f research to engineer novel biosensors

    • Developing strategies for manipulating insect behavior through olfactory pathways

    • Creating computational models that predict olfactory perception from receptor activation patterns

This research contributes to fundamental understanding of how chemical information is detected, encoded, and translated into appropriate behavioral responses across species.

What are common technical challenges in Or85f research and how can they be addressed?

Researchers frequently encounter these challenges when studying Or85f:

  • Low Signal-to-Noise in Electrophysiological Recordings:

    • Problem: Difficulty distinguishing ab10B spikes from background noise or neighboring neurons

    • Solution: Use genetically labeled neurons for targeted recordings; implement spike sorting algorithms; perform recordings in Or49a mutant backgrounds to isolate Or85f-specific responses

  • Variable Expression Levels:

    • Problem: Inconsistent Or85f expression across samples

    • Solution: Standardize fly age (0-2 days post-eclosion for optimal expression); use qRT-PCR to quantify expression levels; ensure presence of Orco co-receptor as it's necessary for maintaining expression

  • Ligand Volatility and Delivery Issues:

    • Problem: Inconsistent delivery of volatile ligands like actinidine and nepetalactol

    • Solution: Implement precise odor delivery systems with controlled flow rates; verify delivered concentrations using photoionization detectors; prepare fresh solutions regularly

  • Background Genetic Effects:

    • Problem: Genetic background influences on Or85f function

    • Solution: Back-cross lines multiple generations; use appropriate genetic controls; implement precise gene editing techniques like CRISPR that minimize off-target effects

  • Receptor Trafficking in Heterologous Systems:

    • Problem: Poor membrane localization in expression systems

    • Solution: Co-express with Orco; optimize codon usage for expression system; use trafficking enhancers; verify localization with fluorescent tags

  • Contradictory Functional Data:

    • Problem: Different studies reporting variable ligand specificities

    • Solution: Standardize testing protocols; consider receptor polymorphisms; examine linkage disequilibrium patterns ; ensure consistent experimental conditions across studies

Addressing these challenges is essential for generating reliable and reproducible data regarding Or85f function and its role in olfactory behavior.

How can researchers verify that recombinant Or85f is properly folded and functional?

To confirm proper folding and functionality of recombinant Or85f:

  • Structural Verification Approaches:

    • Perform limited proteolysis to assess accessibility of cleavage sites

    • Use circular dichroism spectroscopy to evaluate secondary structure content

    • Apply fluorescence-based thermal shift assays to assess protein stability

    • Implement cysteine accessibility assays for transmembrane topology verification

  • Functional Validation Methods:

    • Conduct ligand binding assays with known Or85f ligands (actinidine and nepetalactol)

    • Perform calcium imaging in heterologous systems expressing Or85f+Orco

    • Use patch-clamp electrophysiology to measure channel activity in response to ligands

    • Implement FRET-based interaction assays to verify Or85f-Orco complex formation

  • Cellular Localization Assessment:

    • Use confocal microscopy with fluorescently tagged Or85f to verify membrane localization

    • Perform immunostaining with anti-Or85f antibodies

    • Conduct subcellular fractionation followed by Western blotting

    • Implement surface biotinylation assays to quantify membrane-localized receptor

  • In vivo Validation Strategies:

    • Express recombinant Or85f in Or85f-null flies and test for rescue of function

    • Perform SSR recordings from neurons expressing the recombinant receptor

    • Verify behavioral responses to Or85f ligands in rescue lines

  • Quality Control Benchmarks:

    • Compare dose-response curves to native receptor responses

    • Verify specificity by testing non-ligands and structurally related compounds

    • Assess receptor stability over time and temperature ranges

These comprehensive validation approaches ensure that experimental results truly reflect Or85f properties rather than artifacts of improper folding or trafficking.

What are the most valuable datasets and computational tools for Or85f research?

For advanced Or85f research, these resources and tools are particularly valuable:

  • Genomic and Sequence Databases:

    • FlyBase (https://flybase.org): Comprehensive genomic data for Drosophila species

    • NCBI Reference Sequences: Curated Or85f sequences (Release 6.46)

    • Population genomic datasets: Drosophila Genetic Reference Panel (DGRP) for natural variation

  • Structural Analysis Tools:

    • SWISS-MODEL: For homology modeling of Or85f structure

    • PyMOL/Chimera: Visualization and analysis of receptor models

    • I-TASSER: For ab initio and threading-based structure prediction

  • Ligand Prediction Software:

    • Dragon and Cerius2: For generating molecular descriptors (optimization of ~3424 descriptors recommended)

    • Sequential-Forward-Selection tools: For creating Or-optimized descriptor subsets

    • SNAP software: For haplotype determination and analysis

  • Genomic Analysis Resources:

    • Tassel 2.1 software: For linkage disequilibrium analysis between markers

    • DEXSeq: For exon-by-exon expression analysis

    • STAR and HTSeq: For RNA-Seq alignment and quantification

  • Electrophysiology Analysis Tools:

    • Spike2 or similar software: For spike sorting and quantification

    • R packages for statistical analysis: For dose-response curve fitting

  • Drosophila Stock Resources:

    • Bloomington Drosophila Stock Center: Source for Orco mutant lines (#23130 Orco²)

    • Vienna Drosophila Resource Center: Additional genetic tools

Research shows that Or-optimized descriptor sets using these computational tools significantly outperform non-optimized methods in predicting receptor-ligand interactions .

What genetic tools and fly strains are most useful for Or85f research?

Essential genetic tools and fly strains for Or85f research include:

  • Mutant and Transgenic Lines:

    • Or85f null mutants: For loss-of-function studies

    • UAS-Or85f: For targeted expression and rescue experiments

    • Or85f-GAL4: For driving expression in native Or85f neurons

    • Orco² mutant line (#23130): For studying co-receptor dependency

    • Or49a mutants: For isolating Or85f function in ab10B neurons

  • Reporter Systems:

    • Or85f>GFP: For visualizing expression patterns

    • UAS-GCaMP: For calcium imaging when driven by Or85f-GAL4

    • Or85f>RFP, Or49a>GFP: For co-localization studies

  • Functional Manipulation Tools:

    • UAS-Kir2.1: For silencing Or85f-expressing neurons

    • UAS-TrpA1: For temperature-dependent activation

    • UAS-shiⁱs: For conditional synaptic inhibition

    • Or85f-Gal80: For subtraction approaches in complex expression patterns

  • Genome Editing Tools:

    • CRISPR/Cas9 constructs targeting Or85f: For precise genome editing

    • UAS-Cas9 with Or85f-specific gRNAs: For cell-type specific editing

    • Homology-directed repair templates: For introducing specific mutations

  • Background Controls:

    • Precise genetic background controls: wCS (wild-type) used in many studies

    • Genetic landing site controls: For controlling position effects in transgene expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.