Recombinant Drosophila melanogaster Putative odorant receptor 94a (Or94a)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Drosophila melanogaster Putative odorant receptor 94a (Or94a) is a full-length recombinant protein expressed in Escherichia coli with an N-terminal His tag. It is part of the odorant receptor (OR) family in Drosophila melanogaster and is annotated under the gene symbol Or94a (UniProt ID: Q9VCS9; NCBI RefSeq: CG17241) .

PropertyDetails
SpeciesDrosophila melanogaster (fruit fly)
Source OrganismE. coli
TagN-terminal His tag
Protein LengthFull-length (1–387 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Functional Roles in Olfaction

Or94a is implicated in chemosensory detection, particularly in larvae, where it co-expresses with Or94b in olfactory receptor neurons (ORNs) .

FunctionDetailsCitations
Ligand DetectionResponds to short-chain fatty acids (SCFAs) (e.g., propionic acid) in larvae .
Behavioral ImpactTriggers feeding behavior in larvae; critical for survival in suboptimal conditions .
Co-expressionExpressed with Or94b in the same larval ORN, suggesting complementary roles .
Species-SpecificityReduced attraction to SCFAs in Drosophila suzukii compared to D. melanogaster .

Genetic and Genomic Context

  • Regulatory Elements: Upstream regions of Or94a contain sequence motifs (e.g., Dyad-1, Oligo-1) associated with co-expression in maxillary palp ORNs .

  • Genomic Location: Part of a cluster with Or94b, which are tightly linked (<1 kb apart) and co-regulated .

Research Applications and Findings

Or94a has been studied in the context of olfactory coding and larval behavior:

Study FocusKey FindingsCitations
SCFA DetectionOr94a/Or94b-expressing ORNs mediate propionic acid detection, driving feeding .
Co-receptor ExpressionOr94a is co-expressed with Ir25a in antennal and palpal neurons, expanding its functional scope .
Recombinant ProteinUsed in ELISA assays to study receptor-ligand interactions .

Production and Availability

Recombinant Or94a is commercially available as:

SupplierProduct NameKey FeaturesPrice
Creative BioMartRFL36212DFHis-tagged, >90% purity, lyophilized~$1,743.00

Challenges and Future Directions

  • Binding Specificity: Limited data on adult-specific ligands; further screens are needed .

  • Ecological Relevance: Role in niche adaptation (e.g., D. suzukii vs. D. melanogaster) warrants deeper investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is selected during production. If you require a specific tag type, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
Or94a; CG17241; Odorant receptor 94a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or94a
Target Protein Sequence
MDKHKDRIESMRLILQVMQLFGLWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLM WLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEE VDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPFEWQNERRYWFA YGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRLRETKNMKNDTIFGQQLRAIF IMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSV MILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNF FAVGLPIFVKTINNAYSFLALLLNVSN
Uniprot No.

Target Background

Function
Odorant receptor mediating acceptance or avoidance behavior depending on the substrates. The odorant receptor repertoire encodes a vast array of odor stimuli, exhibiting diverse identity, intensity, and duration. It may form a complex with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG17241

STRING: 7227.FBpp0083734

UniGene: Dm.27602

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Or94a in the Drosophila olfactory system?

Or94a belongs to the multi-gene family of G protein-coupled odorant receptors (ORs) that form the molecular basis of Drosophila olfaction. Like other Drosophila ORs, Or94a likely functions as part of a heteromeric complex with the co-receptor Orco to detect specific volatile compounds. The binding of odorant molecules to these receptors on olfactory sensory neuron (OSN) cilia initiates the neuronal signaling cascade that leads to odor perception .

The Drosophila olfactory system employs approximately 50 different classes of OSNs, each expressing a specific OR or combination of ORs. This organization follows the principle of combinatorial encoding, where the identity of an odor is represented by the activation pattern across multiple OSN classes. In a simplified binary system, 50 OSNs would have a theoretical discriminatory capacity of 2^50 odors .

How can a researcher identify ligands for Or94a?

Ligand identification for Or94a can be approached through several complementary methodologies:

  • Electrophysiological recordings: Single sensillum recordings (SSR) directly measure neuronal responses to odorants in vivo.

  • Calcium imaging: This approach measures Ca²⁺ influx in response to receptor activation in either native neurons or heterologous expression systems.

  • DoOR database analysis: The Database of Odorant Responses (DoOR) project integrates heterogeneous odorant response data into a consensus response matrix. This resource now provides reliable odorant-responses for nearly all Drosophila olfactory responding units, with information on 693 odorants totaling 7381 data points .

  • Heterologous expression systems: Expressing Or94a in systems such as Xenopus oocytes or HEK293 cells enables functional characterization through electrophysiology or fluorescent indicators.

What expression systems are most suitable for recombinant Or94a production?

Several expression systems can be employed for the production of recombinant Or94a:

  • Drosophila Expression System (DES): This system utilizes Drosophila Schneider S2 cells with simple expression vectors allowing stable or transient expression. The advantage is that recombinant proteins are processed in a more native-like cellular environment .

  • Baculovirus Expression Systems: These systems offer high expression levels (up to 500 mg/L) in insect cells such as Sf9, Sf21, or High Five cells. They provide posttranslational modifications approaching that of mammalian cells while offering ease of scale-up .

Table 1. Comparison of Expression Systems for Recombinant Or94a Production

SystemHost CellsPurification TagPromoterExpression MethodKey Advantages
Baculo-DirectSf9, Sf21, or High Five6xHisPolyhedrinInfectionFast method; ideal for high-throughput screening
Bac-to-BacSf9, Sf21, or High Five6xHis-InfectionEnhanced secretion with honeybee melittin signal
DESS2 cellsVarious options-Stable or transientNative posttranslational processing

What are the critical challenges in expressing functional olfactory receptors like Or94a?

Expressing functional olfactory receptors presents several significant challenges:

  • Membrane protein expression difficulties: As seven-transmembrane domain proteins, ORs often exhibit poor folding, aggregation, or toxicity when overexpressed.

  • Co-receptor dependency: Most Drosophila ORs require co-expression with the Orco co-receptor for proper membrane trafficking and function.

  • Posttranslational modifications: Insect cells offer posttranslational modifications approaching those of mammalian cells, allowing production of recombinant protein that is more functionally similar to the native protein than if expressed in yeast or other eukaryotes .

  • Protein stability: ORs may be sensitive to detergents used during purification, requiring careful optimization of solubilization and stabilization conditions.

What factors regulate the expression of odorant receptors in Drosophila?

A systematic RNAi-mediated knockdown of transcription factors identified seven that are essential for the regulation of more than 30 ORs in Drosophila :

  • acj6

  • E93

  • Fer1

  • onecut

  • sim

  • xbp1

  • zf30c

These regulatory factors are differentially expressed in antennal sensory neuron classes and specifically required for the adult expression of ORs. While Or94a was not specifically mentioned in the search results, these transcription factors likely contribute to its regulation in specific combinations .

What is known about the promoter structure of Drosophila odorant receptors?

Bioinformatic and promoter analyses have uncovered a common promoter structure for ORs with distal repressive and proximal activating regions . This organization reveals a prominent role for transcriptional repression in preventing ectopic receptor expression. The combinatorial action of both activation and repression mechanisms allows a small number of transcription factors to specify a large repertoire of neuron classes in the olfactory system .

For Or94a specifically, promoter analysis could identify binding sites for the seven key transcription factors identified by systematic knockdown studies, providing insights into its regulatory mechanisms.

How can site-directed mutagenesis enhance understanding of Or94a structure-function relationships?

Site-directed mutagenesis represents a powerful approach for investigating OR structure-function relationships. Based on studies with mouse ORs, this technique can:

  • Transfer ligand specificity: By exchanging key amino acid residues between related receptors. In mouse ORs, exchanging just two of three residues at equivalent positions of the putative odorant binding site selectively changed ligand preference between related receptors .

  • Modify signaling properties: Mutations can affect not only ligand preference but also signaling activation strength, providing insights into receptor activation mechanisms .

  • Identify critical binding residues: Computer modeling combined with mutagenesis can propose structural details at atomic resolution how the same odorant molecule might interact with different contact residues to induce different functional responses .

For Or94a research, this approach could identify key residues involved in:

  • Odorant recognition and binding

  • Receptor activation

  • Signal transduction efficiency

  • Receptor-Orco interactions

What techniques are available for measuring Or94a activation in response to odorants?

Several complementary techniques can be employed to measure Or94a activation:

  • Electrophysiological recordings: Single sensillum recordings directly measure the firing rate of Or94a-expressing neurons in response to odorants.

  • Calcium imaging: Using calcium-sensitive fluorescent proteins or dyes to visualize neuronal activation patterns in response to odorants. The DoOR project incorporates data from calcium imaging studies, including newly reported responses for several ORs .

  • Heterologous expression with reporter systems: Expression in cell lines with calcium indicators or FRET-based sensors to measure receptor activation.

  • In vivo functional imaging: Visualizing glomerular activation patterns in the antennal lobe through techniques like two-photon calcium imaging.

How conserved are odorant receptors across Drosophila species and what does this reveal about Or94a?

Evolutionary conservation analysis of ORs can provide insights into functional constraints and adaptation:

  • Sequence conservation: Regions under functional constraint typically show higher sequence conservation across species.

  • Binding site conservation: The odorant binding pocket often shows a pattern of conservation reflecting adaptation to specific ecological niches.

  • Ligand specificity evolution: Changes in amino acid residues can alter ligand specificity, as demonstrated in mouse ORs where exchanging just two residues transferred ligand preference between receptors .

For Or94a specifically, comparative genomics across Drosophila species could identify:

  • Functionally critical residues based on evolutionary conservation

  • Species-specific adaptations reflecting different ecological requirements

  • Evidence of positive selection in regions involved in odorant recognition

How do insect odorant receptors like Or94a differ structurally from mammalian receptors?

Insect ORs represent an evolutionarily distinct family from mammalian ORs, with several key differences:

  • Membrane topology: Insect ORs have an inverted membrane topology compared to mammalian ORs.

  • Co-receptor requirement: Insect ORs function as heteromeric complexes with the Orco co-receptor, unlike mammalian ORs.

  • Signal transduction: While mammalian ORs primarily couple to G proteins, insect ORs may function as ligand-gated ion channels in addition to activating G protein pathways.

Despite these differences, studies exchanging ligand-binding specificity between mouse ORs demonstrate principles of structure-function relationships that may apply more broadly to understanding how Or94a recognizes odorants .

How does Or94a contribute to the combinatorial coding of odors in Drosophila?

The Drosophila olfactory system employs a combinatorial coding strategy where odor identity is encoded by the pattern of activation across multiple OSN classes. The DoOR project has made significant progress in mapping these response patterns, revealing how different ORs contribute to this code .

For Or94a specifically, its contribution to this combinatorial code would depend on:

  • Response profile: The range of odorants it responds to and its sensitivity to each.

  • Glomerular targeting: The specific glomerulus in the antennal lobe where Or94a-expressing neurons project.

  • Integration with other channels: How Or94a-mediated signals are integrated with inputs from other OSN classes at higher brain centers.

The DoOR database now includes response profiles for nearly all Drosophila olfactory responding units, allowing researchers to place Or94a responses in the context of the entire olfactory system .

What is known about the anatomical organization of Or94a-expressing neurons?

While the search results don't specifically mention Or94a's anatomical organization, the DoOR project has mapped OSNs to their corresponding glomeruli in the antennal lobe . This mapping is critical for understanding:

  • Circuit integration: How Or94a signals are processed in the antennal lobe.

  • Functional clustering: Whether Or94a-responsive glomeruli are anatomically clustered with functionally related glomeruli.

  • Projection patterns: The connections from Or94a-responsive projection neurons to higher brain centers.

According to the DoOR database, all antennal lobe glomeruli except VA7m have been assigned to specific sensory neurons, providing a framework for understanding where Or94a fits within this anatomical organization .

How can research on Or94a contribute to understanding human olfactory function?

Research on Drosophila ORs like Or94a has significant translational relevance:

  • Genetic conservation: Approximately 75% of human genes have Drosophila homologs, and 50-70% of human genes can rescue phenotypes associated with loss of the homologous gene in Drosophila .

  • Disease modeling: Drosophila has been successfully used to drive diagnosis and understand the mechanisms of rare human diseases, particularly those affecting neuronal development or function. About 65% of applicants to the Undiagnosed Diseases Network are children with neurological symptoms, highlighting the value of Drosophila as a model .

  • Structural insights: While mammalian and insect ORs are evolutionarily distinct, principles of ligand recognition and receptor activation may have parallels that inform our understanding of human olfaction.

What potential biotechnological applications exist for recombinant Or94a?

Recombinantly expressed odorant receptors have several potential applications:

  • Biosensors: Integration into devices for detecting specific volatile compounds in environmental monitoring, food quality control, or medical diagnostics.

  • Drug discovery: As targets for developing novel insect repellents or attractants with agricultural or public health applications.

  • Fundamental research: As tools for understanding the principles of olfactory coding and the molecular basis of odor perception.

  • Structure determination: Recombinant expression and purification could enable structural studies through techniques like cryo-electron microscopy, providing insights into the molecular architecture of insect ORs.

What strategies can improve the functional expression of Or94a?

Several strategies can enhance the functional expression of ORs like Or94a:

  • Optimized expression systems: The Drosophila Expression System using S2 cells provides a native-like environment for proper folding and post-translational modifications .

  • Baculovirus expression systems: These offer high expression levels in insect cells with proper posttranslational modifications approaching those of mammalian cells .

  • Co-expression with chaperones: Adding molecular chaperones may improve folding efficiency.

  • Fusion tags and partners: Strategic placement of purification tags or fusion partners can enhance expression and stability.

  • Expression conditions: Optimizing temperature, induction timing, and media composition can significantly impact functional expression.

How can researchers integrate Or94a data into the broader understanding of the Drosophila olfactome?

The DoOR project provides a framework for integrating new receptor data into a comprehensive understanding of the Drosophila olfactome :

  • Data integration: The DoOR project combines heterogeneous datasets from different experimental approaches into a consensus response matrix.

  • Comparative analysis: New Or94a data can be compared with existing receptor response profiles to identify functional relationships.

  • Receptor-glomerulus mapping: Integration with the antennal lobe map allows placing Or94a within the anatomical organization of the olfactory system.

  • Open-source tools: The DoOR project provides R-based tools for data analysis and visualization, facilitating the integration of new data .

By contributing Or94a data to this collaborative framework, researchers can enhance our understanding of how this receptor contributes to the broader olfactory code of Drosophila.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.