Recombinant Drosophila melanogaster Putative odorant receptor 94b (Or94b)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

Or94b is implicated in larval chemosensation, particularly in detecting bacterial short-chain fatty acids (SCFAs) like propionic acid:

  • Larval Feeding Behavior: Or94b+ neurons mediate attraction to propionic acid, which enhances survival and growth in suboptimal conditions .

  • Co-Receptor Dynamics: Works synergistically with Or30a to detect SCFAs, triggering feeding responses in D. melanogaster larvae .

  • Evolutionary Divergence: Unlike D. suzukii, which avoids fermented fruit, D. melanogaster relies on Or94b for SCFA-driven niche adaptation .

Recombinant Production

  • Expression Systems: Optimized in E. coli for high yield (≥90% purity) .

  • Functional Assays: Used in ELISA, Western Blot (WB), and olfactory neuron activity studies .

Research Applications

  • Olfactory Mechanism Studies: Mapping ligand-receptor interactions for SCFAs .

  • Evolutionary Biology: Comparing odorant receptor function across Drosophila species .

  • Agricultural Pest Control: Insights into D. suzukii’s ecological niche shift inform pest management strategies .

Challenges and Future Directions

  • Heterologous Expression Limitations: Low solubility in E. coli necessitates tag-assisted purification .

  • Unresolved Questions: Role of Or94b in adult olfaction and its interaction with Or83b (coreceptor) require further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
Or94b; CG6679; Odorant receptor 94b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or94b
Target Protein Sequence
MESTNRLSAIQTLLVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLPLTFTYIALMWYE AITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKF WQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGY NVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHT KVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQ IFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIG LPIFVKTINNAYSFFALLLKISK
Uniprot No.

Target Background

Function
Odorant receptor mediating acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encompasses a diverse collection of odor stimuli, varying in identity, intensity, and duration. It may form a complex with Orco to create odorant-sensing units, enabling sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG6679

STRING: 7227.FBpp0083735

UniGene: Dm.27603

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Or94b expression vary across Drosophila development stages?

Expression of Or94b shows temporal specificity across different developmental stages of Drosophila melanogaster. While comprehensive developmental expression data specifically for Or94b is limited in the available literature, odorant receptors typically show stage-specific expression patterns.

Methodologically, to determine the developmental expression profile of Or94b, researchers should:

  • Extract RNA from different developmental stages (embryo, first to third instar larva, pupa, and adult)

  • Perform quantitative RT-PCR using Or94b-specific primers

  • Normalize expression data against stable reference genes

  • Alternatively, use RNA-seq approaches for genome-wide expression profiling

This temporal expression analysis will provide insight into potential stage-specific functions of Or94b in chemosensation across the Drosophila life cycle.

What are the recommended storage and handling protocols for recombinant Or94b protein?

The recombinant Or94b protein requires specific storage conditions to maintain stability and functionality. Based on established protocols, the protein should be stored in Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles, which can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week.

When handling the protein:

  • Thaw frozen aliquots on ice

  • Centrifuge briefly before opening tubes to collect contents

  • Use sterile pipette tips and tubes when working with the protein

  • Minimize exposure to room temperature

  • Consider adding protease inhibitors when using in extended experimental protocols

These careful handling procedures will help maintain protein stability and experimental reproducibility.

What are the optimal conditions for heterologous expression of Or94b in different expression systems?

Heterologous expression of Or94b presents several technical challenges that researchers must address for successful experimental outcomes. The optimal expression system depends on the research question being addressed:

Expression System Comparison for Or94b:

Expression SystemAdvantagesLimitationsOptimization Strategies
S2 Drosophila cellsNative post-translational modifications, Compatible with Orco co-expressionLimited protein yieldUse inducible promoters (metallothionein), Optimize codon usage
Xenopus oocytesSuitable for electrophysiology, Established for GPCR studiesSingle-cell analysis, Labor-intensiveOptimize RNA quality, Co-inject with Orco mRNA
HEK293 cellsHigh transfection efficiency, Amenable to high-throughputNon-native post-translational modificationsUse tetracycline-inducible systems, Include chaperones
Sf9/Sf21 insect cellsInsect-derived, Baculovirus expression systemComplex setupOptimize viral titer, Design specific signal peptides

For optimal results, regardless of the expression system, co-expression with the Orco co-receptor is typically necessary for proper trafficking and function. Additionally, incorporating N-terminal signal sequences and C-terminal epitope tags (avoiding disruption of transmembrane domains) can facilitate detection and purification without compromising function.

How can researchers effectively analyze the ligand-binding properties of Or94b?

Analyzing ligand-binding properties of Or94b requires sophisticated methodological approaches to capture the complex interactions between the receptor and potential odorants. A comprehensive strategy would include:

  • Functional screening approaches:

    • Calcium imaging using fluorescent indicators in Or94b-expressing cells

    • Electrophysiology (patch-clamp) recordings in heterologous systems

    • Single sensillum recordings (SSR) in transgenic Drosophila expressing Or94b in "empty neuron" systems

  • Binding assays:

    • Competitive binding assays using radiolabeled reference ligands

    • Surface plasmon resonance (SPR) with purified receptor

    • Microscale thermophoresis for detecting binding-induced changes

  • Computational approaches:

    • Homology modeling of Or94b structure

    • Molecular docking of candidate ligands

    • Molecular dynamics simulations of receptor-ligand interactions

When interpreting results, researchers should consider that Or94b, like other odorant receptors, may exhibit promiscuity in ligand binding with varying affinities. Creating dose-response curves for each potential ligand and determining EC50 values provides quantitative measures for comparing binding properties.

What are the most effective genetic approaches for studying Or94b function in vivo?

Several genetic approaches can be employed to study Or94b function in the intact organism, each with specific advantages:

  • CRISPR/Cas9-mediated genome editing:

    • Generate precise Or94b knockout lines

    • Create point mutations to study structure-function relationships

    • Introduce reporter genes (GFP/RFP) at the endogenous locus

  • GAL4-UAS system applications:

    • Express Or94b in ectopic neurons using neuron-specific GAL4 drivers

    • Conduct rescue experiments in Or94b mutant backgrounds

    • Perform RNAi-mediated knockdown with tissue specificity

  • Enhancer trap strategies:

    • Identify regulatory elements controlling Or94b expression

    • Study temporal and spatial expression patterns

The effectiveness of these approaches depends on careful experimental design, including:

  • Use of appropriate controls (genetic background matching)

  • Validation of genetic modifications through sequencing and expression analysis

  • Phenotypic characterization at molecular, cellular, and behavioral levels

Recent advances in conditional gene expression systems also allow for temporal control of Or94b manipulation, enabling studies of critical developmental periods for receptor function.

How should researchers design experiments to identify natural ligands for Or94b?

A systematic approach to identifying natural ligands for Or94b should incorporate both hypothesis-driven and unbiased screening strategies:

  • Initial high-throughput screening:

    • Test compound libraries representing diverse chemical classes

    • Include ecologically relevant odorants found in Drosophila habitats

    • Screen at multiple concentrations (typically 10^-9 to 10^-3 M)

  • Validation of candidate ligands:

    • Confirm activity with dose-response analyses

    • Determine activation thresholds and EC50 values

    • Examine structural analogs to define structure-activity relationships

  • In vivo confirmation:

    • Single sensillum recordings from neurons expressing Or94b

    • Behavioral assays (T-maze, flight tracker, etc.) with wild-type and Or94b mutant flies

    • Calcium imaging in the antennal lobe of transgenic flies

  • Data analysis considerations:

    • Use appropriate statistical methods to distinguish true responses from background

    • Account for solvent effects and mechanical stimulation artifacts

    • Include positive controls (known ligands for well-characterized receptors)

This integrated approach maximizes the likelihood of identifying physiologically relevant ligands while minimizing false positives that may result from non-specific effects in heterologous systems.

What are the challenges in recombinant expression and purification of Or94b, and how can they be addressed?

Membrane proteins like Or94b present significant challenges during recombinant expression and purification. Key challenges and solutions include:

Challenge 1: Low expression levels

  • Solution: Optimize codon usage for expression system

  • Use strong inducible promoters

  • Screen multiple cell lines/strains for optimal expression

  • Consider fusion partners (e.g., MBP, SUMO) to enhance solubility

Challenge 2: Protein misfolding and aggregation

  • Solution: Express at lower temperatures (16-20°C)

  • Add chemical chaperones to culture media

  • Co-express with molecular chaperones

  • Include stabilizing ligands during expression

Challenge 3: Extraction and solubilization

  • Solution: Screen detergent panels systematically

  • Use milder detergents (DDM, LMNG) for initial extraction

  • Consider novel solubilization approaches (SMALPs, nanodiscs)

  • Optimize detergent:protein ratios

Challenge 4: Maintaining stability during purification

  • Solution: Include appropriate ligands in purification buffers

  • Maintain consistent detergent concentration above CMC

  • Add lipids to stabilize native-like conformation

  • Use shorter purification protocols with minimal steps

A strategic purification workflow should incorporate affinity chromatography (using epitope tags), followed by size exclusion chromatography to separate aggregates from properly folded protein. Quality control assessments using circular dichroism spectroscopy and thermal stability assays can confirm proper folding before functional studies.

How can researchers effectively analyze Or94b expression patterns in Drosophila tissues?

Comprehensive analysis of Or94b expression requires a multi-faceted approach combining molecular, histological, and genetic techniques:

  • Transcript analysis:

    • Quantitative RT-PCR with tissue-specific RNA extracts

    • RNA-seq for genome-wide comparative expression analysis

    • Single-cell RNA-seq to identify specific neuron populations

  • Protein localization:

    • Immunohistochemistry using Or94b-specific antibodies

    • Generation of Or94b-reporter fusion constructs (Or94b-GAL4>UAS-GFP)

    • Proximity ligation assays to study receptor interactions in situ

  • Functional mapping:

    • Calcium imaging of sensory neurons

    • Electrophysiological recordings from identified neurons

    • Connectome analysis of Or94b-expressing neurons

Data analysis should include:

  • Quantification of expression levels across tissues and developmental stages

  • Co-localization analysis with known neuronal markers

  • 3D reconstruction of expression patterns in complex tissues

When interpreting results, researchers should be aware that odorant receptor expression can be influenced by environmental factors, age, and physiological state of the organism. Therefore, standardizing conditions and including appropriate controls is essential for reproducible results.

What statistical approaches are most appropriate for analyzing Or94b functional data?

The statistical analysis of Or94b functional data requires careful consideration of experimental design and data characteristics:

  • For ligand screening experiments:

    • Use Z-factor analysis to assess assay quality

    • Apply multiple comparison corrections (Bonferroni or FDR) when testing numerous compounds

    • Consider non-parametric tests if normality assumptions are violated

  • For dose-response data:

    • Fit data to appropriate models (Hill equation, logistic regression)

    • Calculate EC50/IC50 values with confidence intervals

    • Compare potency and efficacy across ligands using extra sum-of-squares F test

  • For electrophysiological recordings:

    • Apply mixed-effects models for repeated measures

    • Analyze both response amplitude and temporal kinetics

    • Consider Bayesian approaches for complex response patterns

  • For behavioral assays:

    • Use appropriate transformations for non-normal data

    • Consider survival analysis for time-to-response data

    • Account for individual variation with hierarchical models

When reporting results, include detailed statistical methods, justification for tests chosen, power analyses, and effect sizes alongside p-values to provide a complete picture of the findings' significance and reliability.

How can researchers address contradictory findings in Or94b research literature?

When faced with contradictory findings in the literature regarding Or94b function or properties, researchers should consider several methodological approaches:

  • Systematic evaluation of methodological differences:

    • Compare expression systems used (cell types, constructs)

    • Examine experimental conditions (temperature, pH, ionic composition)

    • Assess detection methods and their sensitivity

    • Consider genetic background differences in Drosophila strains

  • Direct replication studies:

    • Reproduce original protocols with high fidelity

    • Include original materials when possible (plasmids, fly lines)

    • Increase statistical power to detect smaller effects

    • Pre-register replication protocols to avoid bias

  • Reconciliation approaches:

    • Design experiments that test multiple hypotheses simultaneously

    • Develop unified models that could explain apparently contradictory results

    • Collaborate with labs reporting different findings for joint investigation

  • Meta-analysis strategies:

    • Conduct formal meta-analysis when sufficient studies exist

    • Weight studies based on methodological quality and sample size

    • Examine publication bias through funnel plots

Contradictions in the literature may reflect biological realities rather than experimental errors—Or94b may function differently under varying conditions or in different genetic backgrounds. A comprehensive approach that embraces this complexity will advance understanding more effectively than simply dismissing contradictory findings.

How can Or94b research contribute to understanding evolutionary conservation of olfactory mechanisms?

Or94b research provides a valuable model for investigating evolutionary aspects of olfactory systems:

  • Comparative genomic approaches:

    • Identify Or94b orthologs across Drosophilidae and other insect families

    • Conduct phylogenetic analyses to trace receptor evolution

    • Calculate selection pressures (dN/dS ratios) on different receptor domains

  • Functional conservation analysis:

    • Express Or94b orthologs from different species in standardized systems

    • Compare ligand specificity and sensitivity across species

    • Identify conserved versus divergent functional motifs

  • Ecological correlation studies:

    • Relate receptor properties to species-specific ecological niches

    • Investigate how receptor tuning relates to host specialization

    • Examine co-evolution with specific environmental odorants

This evolutionary perspective can reveal fundamental principles about how olfactory systems adapt to environmental challenges and may identify conserved mechanisms that extend beyond insects to other phyla.

What are the potential applications of Or94b research in developing novel insect control strategies?

Understanding Or94b function has significant implications for applied entomology and pest management:

  • Target validation approaches:

    • Determine if Or94b is involved in host-seeking or oviposition behaviors

    • Assess evolutionary conservation of Or94b across pest Diptera species

    • Evaluate fitness impacts of Or94b disruption

  • Screening platforms for novel semiochemicals:

    • Develop high-throughput assays using Or94b-expressing cells

    • Screen for super-agonists, antagonists, or inverse agonists

    • Identify compounds that cause receptor internalization or desensitization

  • Translational research directions:

    • Design molecular baits incorporating Or94b ligands

    • Develop behavior-modifying compounds targeting Or94b

    • Explore gene drive technologies targeting Or94b loci in pest species

Researchers should consider both efficacy and specificity when evaluating potential control strategies, with particular attention to off-target effects on beneficial insects and resistance development. Integrating Or94b-based approaches with existing control methods may provide more sustainable pest management solutions.

How might recombination analysis techniques enhance our understanding of Or94b genomic organization?

Recombination analysis can provide insights into the genomic context and evolutionary history of Or94b:

  • Fine-scale mapping approaches:

    • Use recombination markers to precisely locate Or94b in the genome

    • Map regulatory elements through recombination breakpoint analysis

    • Identify linkage relationships with other olfactory genes

  • Structural variation analysis:

    • Examine copy number variation of Or94b across populations

    • Investigate potential gene conversion events within odorant receptor families

    • Detect inversions or translocations affecting Or94b expression

  • Recombination rate plasticity considerations:

    • Analyze whether maternal age affects recombination in the Or94b genomic region

    • Investigate temperature or stress effects on recombination near Or94b

    • Compare recombination rates in laboratory versus wild populations

Recent studies have shown that recombination rates can be influenced by factors such as maternal age, with specific patterns observed in Drosophila . Such recombination rate plasticity may impact the genetic diversity of odorant receptor genes and contribute to adaptive potential in changing environments. Researchers should consider these dynamic aspects when interpreting genetic variation in Or94b across populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.