Recombinant Drosophila melanogaster Putative odorant receptor 98b (Or98b)

Shipped with Ice Packs
In Stock

Description

Protein Properties

The recombinant form of Or98b is typically produced with a His-tag, which facilitates purification and isolation for research purposes. When expressed in E. coli systems, the protein maintains its structural integrity, allowing for detailed biochemical and functional studies .

PropertyDescription
Protein Length384 amino acids (full length)
Uniprot IDQ9VAW0
Recommended Storage-20°C to -80°C (long-term); 4°C (up to one week)
Expression SystemE. coli
Purification TagHis-tag (typically N-terminal)
Purity>90% (SDS-PAGE)

Genomic Organization

The Or98b gene is one of approximately 62 odorant receptor genes identified in Drosophila melanogaster. In the nomenclature system for Drosophila odorant receptors, genes are named according to their positions in the cytological map, with Or98b specifically located in band 98 .

Evolutionary Conservation

Evolutionary analysis of Drosophila odorant receptor genes reveals that most Or genes, including Or98b, have been subject to purifying selection, suggesting functional conservation across species . While Or83b (the co-receptor) shows the strongest conservation with a dN/dS ratio of 0.0349, other Or genes including Or98b display varying degrees of sequence divergence across Drosophila species .

In comparative studies across 11 Drosophila species, Or98b is classified in the same orthologous group as Or98a and Or98P, indicating a potential evolutionary relationship between these receptors . The nomenclature and classification of these receptors provide important insights into their evolutionary history and functional relationships.

Odorant Reception Mechanism

Drosophila odorant receptors, including Or98b, function as ligand-gated ion channels composed of a specific tuning receptor (Or98b in this case) and the co-receptor Or83b (Orco) . This heterodimeric complex forms non-selective cation channels that open in response to specific odorant molecules .

The specificity of odorant detection is determined by the unique tuning receptor, which in this case is Or98b. While the specific odorants that activate Or98b have not been fully characterized in the provided search results, the general mechanism involves:

  1. Odorant binding to the receptor complex

  2. Conformational changes in the receptor

  3. Opening of the ion channel

  4. Depolarization of the olfactory neuron

  5. Signal transduction to the brain

Regulation of Receptor Activity

Recent research has revealed important regulatory mechanisms for odorant receptor function. Phosphorylation plays a critical role in modulating receptor responses, with the kinase PKC98E identified as responsible for phosphorylating serine 289 on the Orco subunit . This phosphorylation is required for normal peak olfactory neuron responses, while dephosphorylation during prolonged odorant exposure leads to a process termed "slow desensitization" .

While the specific regulatory mechanisms for Or98b have not been fully elucidated in the search results, it likely follows similar patterns of regulation as other members of the odorant receptor family in Drosophila.

Expression Systems

Recombinant Or98b is typically produced in bacterial expression systems, with E. coli being the predominant host . The protein is expressed with an N-terminal His-tag to facilitate purification using affinity chromatography techniques .

Functional Studies

Recombinant Or98b provides a valuable tool for investigating the molecular basis of olfaction in Drosophila. While specific studies focusing exclusively on Or98b were not detailed in the search results, research approaches using recombinant odorant receptors typically include:

  1. In vitro ligand binding assays to identify specific odorants recognized by the receptor

  2. Electrophysiological studies to characterize channel properties

  3. Structural analysis to understand receptor-ligand interactions

Comparative Studies with Other Odorant Receptors

The availability of recombinant odorant receptors enables comparative studies between different receptors. For instance, research has shown that polymorphisms in odorant receptor genes, including Or10a, Or43a, and Or67b, are associated with variations in behavioral responses to odorants like benzaldehyde and acetophenone . Similar approaches could be applied to study Or98b's role in odorant perception.

Targeted Mutation Studies

Gene targeting approaches have been successfully used to generate null mutants of odorant receptors, such as Or43b, revealing their specific roles in odor-evoked behavioral responses . Similar methodologies could be applied to Or98b to elucidate its specific function in the olfactory system of Drosophila.

Comparative Analysis with Other Odorant Receptors

Drosophila melanogaster possesses approximately 62 odorant receptor genes, each with distinct properties and odorant specificities . While Or98b shares the general structural and functional characteristics of other Drosophila odorant receptors, each receptor has evolved to detect specific sets of odorants.

ReceptorKey FeaturesEvolutionary PressureFunction
Or98b384 amino acids, forms heterodimer with OrcoPurifying selectionPutative odorant detection (specific ligands not fully characterized)
Or83b (Orco)Most conserved receptor (92% sequence identity)Strongest purifying selection (dN/dS = 0.0349)Co-receptor required for proper localization and function of all other Or proteins
Or10aAssociated with variation in responsiveness to benzaldehyde and acetophenonePossible positive selectionDetected by PAML analysis (M7 vs M8 test)
Or43aAssociated with variation in responsiveness to benzaldehyde and acetophenonePossible positive selectionDetected by PAML analysis (M7 vs M8 test)
Or43bNull mutant generated by gene targetingNot specified in search resultsDemonstrated defects in odor-evoked responses

This comparative analysis highlights the unique properties of each odorant receptor while placing Or98b within the broader context of the Drosophila olfactory system .

Future Research Directions

Research on recombinant Or98b and other Drosophila odorant receptors continues to evolve, with several promising avenues for future investigation:

  1. Detailed structural studies to elucidate the three-dimensional conformation of Or98b and its interaction with the Orco co-receptor

  2. Comprehensive ligand screening to identify the specific odorants recognized by Or98b

  3. Investigation of Or98b polymorphisms in natural Drosophila populations and their association with behavioral variations

  4. Exploration of the regulatory mechanisms controlling Or98b expression and function

  5. Development of targeted gene editing approaches to generate Or98b mutants for functional studies

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Or98b; CG1867; Putative odorant receptor 98b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or98b
Target Protein Sequence
MLTDKFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFMPLTIAFGLQNVQNV EQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRR DQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIIS YFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQ LYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQV SIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEA NRETLITVSKAFIKVSKKTPQVND
Uniprot No.

Target Background

Function
Odorant receptor 98b (Or98b) in Drosophila melanogaster mediates acceptance or avoidance behavior based on its substrates. The odorant receptor repertoire encompasses a vast collection of odor stimuli with diverse identities, intensities, and durations. Or98b may interact with Orco to form odorant-sensing units, facilitating sensitive and prolonged odorant signaling and calcium permeability.
Database Links
Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Or98b and what is its role in Drosophila olfaction?

Or98b (Putative odorant receptor 98b) is a member of the odorant receptor family in Drosophila melanogaster. Like other conventional ORs in Drosophila, Or98b functions in conjunction with the co-receptor OR83b (also known as Orco) to form functional heterodimeric complexes that detect specific odorants. These receptors are expressed in olfactory sensory neurons (OSNs) and are essential for the fruit fly's ability to detect and discriminate various chemical stimuli in its environment . Unlike vertebrate olfactory receptors, Drosophila ORs including Or98b adopt an atypical membrane topology with N-termini and the most conserved loops positioned in the cytoplasm .

How does Or98b differ structurally from vertebrate odorant receptors?

Unlike vertebrate and nematode chemosensory receptors which are G protein-coupled receptors (GPCRs) with seven transmembrane domains and an extracellular N-terminus, Drosophila Or98b and other insect ORs have an inverted topology with intracellular N-termini. This atypical membrane organization represents an insect-specific evolutionary solution for odor recognition . The conserved cytoplasmic loops mediate direct association with OR83b to form functional heteromeric complexes, creating a novel topological design for insect olfactory signal transduction .

What are the optimal storage conditions for recombinant Or98b protein?

For recombinant Or98b protein (product code CSB-YP895586DLU1), storage conditions significantly impact protein stability and shelf life. The lyophilized form maintains integrity for approximately 12 months when stored at -20°C/-80°C, while the reconstituted liquid form has a reduced shelf life of about 6 months at the same temperature . Working aliquots can be stored at 4°C but should be used within one week. Importantly, repeated freeze-thaw cycles should be avoided as they lead to protein degradation and loss of functional activity .

What is the recommended protocol for reconstituting lyophilized Or98b?

When reconstituting lyophilized Or98b protein, first briefly centrifuge the vial to collect contents at the bottom. Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. For long-term storage stability, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C . This glycerol addition protects the protein from freeze damage and helps maintain structural integrity during storage.

What quality control metrics should be used to assess recombinant Or98b purity?

The primary quality control method for recombinant Or98b is SDS-PAGE analysis, with commercial preparations typically having >85% purity . Researchers should verify protein identity through Western blotting using Or98b-specific antibodies or mass spectrometry analysis. Additionally, functional assays examining the protein's ability to interact with OR83b/Orco should be performed to confirm biological activity, particularly before conducting binding or structural studies.

How does Or98b interact with OR83b/Orco at the molecular level?

Or98b interacts with OR83b through its cytoplasmic loops that are highly conserved among insect odorant receptors. This interaction occurs early in the endomembrane system of olfactory sensory neurons . The OR83b co-receptor is essential for proper trafficking of Or98b to the ciliated sensory compartment where odor detection occurs. Without OR83b, Or98b remains trapped in the cell body and cannot reach the dendrites . The heterodimeric Or98b/OR83b complex forms a functional unit necessary for odorant-induced signaling, with both proteins contributing to the formation of the ion channel through which signal transduction occurs .

What experimental approaches can be used to study Or98b/OR83b heterodimerization?

Researchers can employ several techniques to investigate Or98b/OR83b heterodimerization:

  • Co-immunoprecipitation assays using tagged versions of Or98b and OR83b to detect physical interactions

  • Bimolecular Fluorescence Complementation (BiFC) where each protein is fused to complementary fragments of a fluorescent protein

  • Förster Resonance Energy Transfer (FRET) microscopy using Or98b and OR83b tagged with appropriate fluorophore pairs

  • Heterologous expression systems (such as Xenopus oocytes or HEK293 cells) combined with electrophysiology to assess functional interactions

  • In vivo trafficking assays in Drosophila OSNs using fluorescently tagged Or98b with and without OR83b expression

These approaches provide complementary insights into both the physical association between these proteins and the functional consequences of their interaction.

What types of polymorphisms have been identified in Or98b among Drosophila populations?

Genetic analyses have revealed significant polymorphisms in Or98b across different Drosophila populations. Notably, Or98b exhibits long deletions that span coding regions in some wild populations . In particular, researchers encountered difficulties amplifying Or98b fragments from certain African Drosophila strains, suggesting the presence of large structural variations that affect multiple primer binding sites within the gene . These deletions represent important genetic variations that could impact olfactory function and provide insights into the evolutionary processes shaping chemosensory systems in Drosophila.

What are effective approaches for analyzing Or98b expression patterns in Drosophila OSNs?

To analyze Or98b expression patterns in Drosophila OSNs, researchers can use:

  • RNA in situ hybridization with Or98b-specific riboprobes to visualize mRNA localization in antennal tissue sections

  • Immunohistochemistry using antibodies against Or98b (if available) or epitope-tagged versions

  • Reporter gene constructs where Or98b promoter elements drive expression of fluorescent proteins

  • Single-cell RNA sequencing of OSN populations to quantify Or98b expression levels across different neuronal subtypes

  • RT-PCR or qPCR analyses on isolated antennal tissue for relative quantification of Or98b expression

These methods can be combined with OR83b co-labeling to confirm co-expression patterns, as OR83b is found in approximately 70-80% of antennal OSNs .

What functional assays can be used to characterize Or98b ligand specificity?

Several complementary approaches can be used to characterize Or98b ligand specificity:

  • Single-sensillum recordings (SSR) from Or98b-expressing OSNs exposed to odor panels

  • Calcium imaging of OSN dendrites expressing genetically encoded calcium indicators

  • Heterologous expression systems (Xenopus oocytes, HEK293 cells) combined with electrophysiology or calcium imaging

  • Behavioral assays measuring attraction or repulsion to candidate ligands in wild-type versus Or98b mutant flies

  • Computational modeling based on OR structure to predict ligand binding properties

When conducting these assays, it's essential to co-express OR83b with Or98b, as functional response requires the presence of both receptors .

Why is it difficult to amplify Or98b from certain Drosophila strains?

Difficulties in amplifying Or98b from certain Drosophila strains, particularly from African populations, likely stem from the presence of large genomic deletions or significant sequence variations that prevent primer binding . When standard PCR amplification fails, researchers have attempted multiple primer sets targeting different regions of Or98b but still encountered amplification failures, suggesting substantial structural variations rather than point mutations . This presents a methodological challenge requiring specialized approaches such as genome walking, long-range PCR, or whole-genome sequencing to characterize these variants fully.

How can researchers address stability issues with recombinant Or98b protein?

To address stability issues with recombinant Or98b protein, researchers should implement several strategies:

  • Optimize buffer conditions by testing various pH values, salt concentrations, and additives

  • Add stabilizing agents such as glycerol (5-50%) to prevent freeze-damage during storage

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Consider protein engineering approaches to improve stability, such as introducing stabilizing mutations or using fusion partners

  • Explore alternative expression systems if yeast-derived protein exhibits inherent instability

  • Monitor protein quality regularly using analytical methods like size-exclusion chromatography or dynamic light scattering

These approaches can significantly extend the functional lifetime of recombinant Or98b preparations.

How does the atypical membrane topology of Or98b impact structural studies?

The unusual inverted membrane topology of Or98b, with intracellular N-termini and cytoplasmic conserved loops, creates unique challenges for structural biology approaches . This atypical arrangement differs fundamentally from well-characterized GPCRs, requiring modified experimental designs. Researchers attempting crystallography or cryo-EM studies of Or98b should consider:

  • Using the recent cryo-EM structure of Orco (OR83b) from Apocrypta bakeri as a template for structural modeling

  • Designing constructs that stabilize the Or98b/OR83b complex for co-crystallization attempts

  • Employing nanobody or antibody fragments that recognize extracellular epitopes to facilitate crystallization

  • Utilizing lipid cubic phase or other membrane-mimetic environments optimized for this unusual topology

  • Implementing directed evolution approaches to identify stabilizing mutations that preserve function

What approaches can be used to study the dynamics of Or98b trafficking in live OSNs?

To investigate the dynamics of Or98b trafficking in living olfactory sensory neurons, researchers can employ:

  • Time-lapse confocal microscopy of fluorescently tagged Or98b in cultured OSNs or in vivo

  • Photoactivatable or photoconvertible fluorescent protein fusions to track newly synthesized Or98b

  • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility and turnover rates

  • Temperature-sensitive OR83b mutants combined with Or98b tracking to analyze co-trafficking requirements

  • Correlative light and electron microscopy to visualize Or98b localization with nanoscale resolution

Research has shown that Or98b requires continuous expression of OR83b for maintenance in sensory cilia, with progressive loss of localization following OR83b depletion . These approaches could further elucidate the kinetics and regulatory mechanisms of this process.

How can Or98b be utilized in developing novel insect repellents?

The Or98b/OR83b complex represents a potential target for developing insect-specific repellents due to its essential role in olfaction and its structural divergence from vertebrate olfactory receptors . Research strategies include:

  • High-throughput screening of compound libraries for molecules that disrupt Or98b/OR83b heterodimer formation

  • Structure-based design of compounds targeting the Or98b/OR83b interface based on available structural data

  • Development of allosteric modulators that bind to Or98b and modify its responsiveness to attractant odors

  • Testing candidate compounds in electrophysiological assays followed by behavioral validation

  • Comparative analysis across insect species to identify conserved binding sites for broad-spectrum repellents

The insect-specific nature of this receptor complex makes it an attractive target for selective control strategies that would have minimal impact on non-target organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.