Recombinant Drosophila melanogaster Putative odorant receptor 9a (Or9a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

Or9a forms heteromeric complexes with the odorant receptor co-receptor (ORCO) to mediate odorant signaling. Key functional insights include:

  • Odorant Sensing: Or9a-ORCO complexes enable calcium-permeable ion channel activity, critical for prolonged odorant detection .

  • Behavioral Modulation: Odorant binding to Or9a triggers acceptance or avoidance behaviors, depending on ligand identity and concentration .

  • Phosphorylation Regulation: ORCO phosphorylation at S289 by PKC98E kinase modulates odorant response kinetics, indirectly influencing Or9a activity .

Interaction Network

Or9a interacts with multiple olfactory receptors and co-receptors, as identified via STRING database analysis :

Interaction PartnerFunctional RoleScore
Or42bMediates responses to ethyl acetate and pentyl acetate; shares structural homology0.790
Or67bInvolved in responses to pyrazines and nonanoic acid0.789
OrcoMandatory co-receptor for odorant detection and signal transductionN/A

4.1. Deorphanization and Ligand Profiling

While Or9a remains partially deorphanized, recent studies from the Drosophila Odorant Response (DoOR) project suggest:

  • Broad Ligand Spectrum: Or9a likely responds to multiple odorants, similar to Or69a, which detects 3-hydroxyhexanoate and α-terpineol .

  • Genetic Variation: Polymorphisms in Or genes, including Or9a, correlate with natural variation in olfactory behavior .

Technical Considerations for Experimental Use

  • Activity Assays: Use calcium imaging or electrophysiology to quantify ligand-induced responses .

  • Stability: Lyophilized Or9a retains activity for 12 months at -80°C; liquid formulations degrade within one week at 4°C .

Open Questions and Future Directions

  • Ligand Specificity: Comprehensive ligand screens are needed to fully deorphanize Or9a .

  • In Vivo Dynamics: How Or9a integrates with IR and GR chemoreceptors in co-expressing neurons remains unresolved .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it for your order.
Synonyms
Or9a; CG15302; Odorant receptor 9a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Or9a
Target Protein Sequence
MSDKVKGKKQEEKDQSLRVQILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFL AAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDA REIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYD LQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKE ELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF IAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQ MKGYFFEASMATFSTIVRSAVSYIMMLRSFNA
Uniprot No.

Target Background

Function
This odorant receptor mediates acceptance or avoidance behavior in *Drosophila melanogaster*, depending on its substrates. The odorant receptor repertoire comprises a diverse set of odor stimuli, each varying in identity, intensity, and duration. Or9a may form a complex with Orco to create odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability.
Database Links

KEGG: dme:Dmel_CG15302

STRING: 7227.FBpp0071396

UniGene: Dm.26600

Protein Families
Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in olfactory sensory neurons in the antenna.

Q&A

What is Drosophila melanogaster Putative odorant receptor 9a (Or9a)?

Or9a belongs to the odorant receptor (Or) family in Drosophila melanogaster, which consists of approximately 60 genes distributed throughout the genome . Like other insect odorant receptors, Or9a likely functions in detecting specific environmental odorants. In Drosophila, odorant receptors form ligand-gated nonselective cation channels, typically as heteromeric complexes with the Or83b (also known as Orco) co-receptor . These channels are activated when appropriate odorant molecules bind to the receptor, leading to depolarization of the olfactory sensory neuron (OSN) and generation of action potentials that convey olfactory information to the antennal lobe of the fly brain.

How is Or9a expressed in the Drosophila olfactory system?

Or9a would be expressed in specific olfactory sensory neurons located in the antennae or maxillary palps. Typically, each OSN class expresses one specific odorant receptor gene along with the Orco co-receptor, although recent research has challenged this traditional view by demonstrating co-expression of multiple chemoreceptor families . OSNs expressing the same receptor project their axons to a specific glomerulus in the antennal lobe, creating a spatial map of odor detection . To accurately visualize Or9a expression patterns, researchers might consider using knock-in strategies similar to those employed for other odorant receptors, where T2A-QF2 cassettes have been used to capture endogenous expression patterns while maintaining normal gene function .

What model systems are available for studying Or9a function?

Several experimental systems can be utilized to study Or9a function:

  • Genetic manipulation in Drosophila: Using CRISPR-Cas9 for gene editing or the GAL4/UAS system for targeted expression or knockdown.

  • Electrophysiological recordings: Single sensillum recordings (SSR) can measure neuronal responses to odorants in intact antennae, providing direct evidence of Or9a activation by specific ligands .

  • Heterologous expression systems: Expression in Xenopus oocytes, HEK293 cells, or other cell lines allows for characterization of receptor properties in isolation.

  • Behavioral assays: Quantitative assessment of olfactory behaviors in wild-type flies compared to those with Or9a mutations or altered expression levels can reveal the receptor's behavioral significance .

  • Calcium imaging: Visualization of neuronal activity in response to odorants can map the functional properties of Or9a-expressing neurons.

How do polymorphisms in Or9a contribute to variation in olfactory behavior?

Natural variation in odorant receptor genes has been linked to differences in olfactory behavior in Drosophila populations. Research on other Or genes has shown that sequence variants can significantly affect behavioral responses to specific odorants . To investigate Or9a polymorphisms:

  • Sequence analysis: Sequence Or9a alleles from natural populations to identify variants and analyze signatures of selection or neutrality.

  • Linkage disequilibrium analysis: Examine recombination history between polymorphic markers, as extensive recombination has been observed in other Or genes .

  • Association studies: Correlate specific polymorphisms with variation in behavioral responses to potential Or9a ligands.

  • Cross-odorant validation: Test behavioral responses to structurally similar odorants to verify associations, as patterns may be similar across related compounds .

  • Functional characterization: Use electrophysiology to determine whether behavioral differences correspond to changes in neuronal responses.

How does the co-expression of Or9a with other chemoreceptors affect odor coding?

Recent research has challenged the traditional view that olfactory neurons express receptors from only one chemosensory gene family. Evidence demonstrates extensive overlap in expression among different co-receptors in Drosophila olfactory neurons . For example, Ir25a (an ionotropic receptor co-receptor) is expressed in 88% of all olfactory sensory neuron classes and co-expressed in 82% of Orco+ neuron classes .

For Or9a, potential co-expression with ionotropic receptors could:

  • Expand response profiles: Enable detection of a broader range of odorants through multiple receptor types.

  • Modify signaling properties: Alter sensitivity, response kinetics, or adaptation properties.

  • Enable signal integration: Allow for integration of signals from different chemosensory pathways within a single neuron.

  • Affect development: Influence the development or maintenance of proper neuronal connectivity.

To investigate this phenomenon for Or9a, researchers could:

  • Implement knock-in strategies targeting Or9a and co-receptor genes

  • Perform single sensillum recordings from Or9a neurons in co-receptor mutant backgrounds

  • Use optogenetics to selectively activate different receptor types within the same neuron

What approaches are most effective for functional expression of recombinant Or9a?

Expressing functional insect odorant receptors in heterologous systems presents several challenges due to their unique properties. Drosophila odorant receptors have an atypical membrane topology with a cytoplasmic N terminus and an extracellular C terminus , and they function as heteromeric complexes with the Orco co-receptor.

Table 2.3: Optimization Strategies for Functional Or9a Expression

StrategyApproachConsiderations
Expression SystemInsect cell lines (Sf9, High Five)More appropriate post-translational modifications
HEK293T cellsWidely used but may require optimization
Xenopus oocytesGood for electrophysiology studies
Co-expressionOrco co-receptorEssential for proper receptor function
Molecular chaperonesMay improve folding and trafficking
Protein EngineeringFusion partners (GFP, MBP)Can improve expression and folding
Codon optimizationEnhances translation efficiency
Membrane EnvironmentDetergent screeningIdentify conditions that maintain stability
Nanodiscs or liposomesProvide native-like membrane environment
ValidationLigand binding assaysConfirm functionality
Calcium imagingAssess signaling capabilities
Patch-clamp electrophysiologyCharacterize channel properties

How can CRISPR-Cas9 be optimized for generating Or9a knock-in fly lines?

CRISPR-Cas9 gene editing offers a powerful approach for generating Or9a knock-in lines. Based on recent advances in Drosophila genetic engineering, the following methodology is recommended:

  • gRNA design:

    • Design highly specific gRNAs targeting unique sequences near the Or9a stop codon

    • Use software tools to minimize off-target effects

    • Consider using two gRNAs to increase editing efficiency

  • Donor template construction:

    • Incorporate homology arms of 500-1000 bp flanking the insertion site

    • Consider a T2A-QF2 cassette strategy, which has been successfully used for other chemosensory receptors

    • Include fluorescent markers (e.g., mCherry) for screening

  • Delivery method:

    • Inject embryos with Cas9 protein, gRNA, and donor template

    • Consider using Cas9 under germline-specific promoters for heritable modifications

  • Screening strategy:

    • Use fluorescence microscopy to identify potential transformants

    • Confirm correct integration by PCR and sequencing

    • Validate expression pattern using reporter systems like QUAS-GFP

This methodology allows for tagging Or9a while maintaining its endogenous expression pattern and normal function, as demonstrated with other chemosensory receptors in Drosophila .

What electrophysiological techniques are most suitable for characterizing Or9a-expressing neurons?

Several electrophysiological techniques can be employed to characterize Or9a-expressing neurons, each with specific advantages:

  • Single Sensillum Recording (SSR):

    • Enables direct measurement of neuronal responses to odorants in intact antennae

    • Provides excellent temporal resolution of spike frequency

    • Allows for precise characterization of response dynamics and specificity

    • Has been successfully used to study other odorant receptors in Drosophila

  • Whole-Cell Patch Clamp:

    • Offers detailed characterization of channel properties

    • Allows for control of both intracellular and extracellular environments

    • Can measure membrane properties and current-voltage relationships

    • Suitable for dissociated neurons or brain slice preparations

  • Electroantennogram (EAG):

    • Measures summed activity across many olfactory neurons

    • Useful for rapid screening of odor responses

    • Less technically demanding than SSR or patch clamp

    • Limited in resolving responses of specific neuron types

For optimal results, combine these techniques with genetic tools (e.g., Or9a-GAL4 driving UAS-GFP) to identify the specific neurons of interest. When recording from Orco+ neurons, consider potential contributions from co-expressed receptors like Ir25a, as single sensillum recordings from Ir25a mutant sensilla have revealed subtle changes in odor responses in Orco+ neurons .

What behavioral assays are most appropriate for evaluating Or9a function?

Behavioral assays are essential for understanding the functional significance of Or9a in olfactory perception. Based on approaches used for other odorant receptors, several methods are particularly suitable:

  • T-maze olfactory choice assays:

    • Allow quantification of attraction or repulsion to specific odorants

    • Can be used to compare wild-type flies with Or9a mutants or manipulated lines

    • Permit testing of dose-dependent behavioral responses

    • Enable assessment of how Or9a contributes to specific odor preferences

  • Flight simulator/tethered fly assays:

    • Allow precise control of odor presentation while monitoring behavioral responses

    • Enable real-time tracking of behavioral dynamics

    • Can be combined with calcium imaging for simultaneous monitoring of neural activity

  • Trap assays:

    • Assess longer-term olfactory preferences

    • Useful for screening multiple odorants or concentrations simultaneously

    • Can reveal subtle behavioral effects that might not be apparent in short-term assays

  • Larval chemotaxis assays:

    • Simpler preparation with fewer confounding variables

    • Allow for higher throughput screening

    • Can reveal developmental aspects of Or9a function

When designing these experiments, it's crucial to consider genetic background effects and to include appropriate controls, such as flies with mutations in other odorant receptors or with rescued Or9a expression in mutant backgrounds.

How should sequencing data for Or9a variants be analyzed to identify functional polymorphisms?

Analysis of Or9a sequence variants requires a comprehensive approach to identify functionally relevant polymorphisms:

  • Population genetics analyses:

    • Calculate nucleotide diversity (π) and other diversity metrics

    • Test for deviations from neutrality using statistics such as Tajima's D

    • Look for signatures of selection that have been observed in other odorant receptor genes like Or42b and Or85f

    • Perform linkage disequilibrium analyses to examine recombination history between polymorphic markers

  • Structural mapping:

    • Predict the impact of amino acid substitutions based on their location in the protein

    • Map variants onto predicted transmembrane domains and ligand-binding regions

    • Compare with known functional domains in other odorant receptors

  • Association studies:

    • Correlate specific polymorphisms with variation in electrophysiological or behavioral responses

    • Verify associations with independent sets of measurements using structurally similar odorants

    • Develop haplotype maps to identify combinations of variants that may act together

  • Functional validation:

    • Generate transgenic lines expressing specific Or9a variants

    • Use site-directed mutagenesis to introduce specific polymorphisms in heterologous expression systems

    • Compare receptor function using electrophysiology or calcium imaging

How can transcriptomic data inform our understanding of Or9a regulation?

Transcriptomic analysis can provide valuable insights into the regulation of Or9a expression:

  • Expression profiling across tissues and developmental stages:

    • Characterize the temporal and spatial patterns of Or9a expression

    • Identify potential developmental regulators by correlating expression patterns

    • Compare expression with other odorant receptors to identify co-regulated genes

  • Analysis of regulatory elements:

    • Identify promoter and enhancer regions controlling Or9a expression

    • Look for transcription factor binding sites through computational analysis

    • Validate regulatory elements using reporter constructs

  • Response to environmental conditions:

    • Assess how Or9a expression changes in response to different odorants or environmental stressors

    • Examine whether spaceflight conditions affect Or9a expression, as Drosophila has been used in spaceflight research

    • Investigate potential epigenetic modifications that might influence expression

  • Single-cell RNA sequencing analysis:

    • Characterize the full transcriptome of Or9a-expressing neurons

    • Identify co-expressed receptors and signaling components

    • Discover novel markers for these specific neuronal populations

When analyzing transcriptomic data, it's important to consider that most natural variants associated with quantitative traits are often in intergenic/intronic regions and presumably affect phenotypes via regulation of gene expression . Additionally, the effects of these variants are typically context-dependent, as demonstrated in studies of expression under different temperature conditions .

How should conflicting results from different functional assays of Or9a be reconciled?

When facing conflicting results from different functional assays of Or9a, a systematic approach to reconciliation is necessary:

  • Consider the biological context of each assay:

    • In vivo vs. in vitro systems

    • Heterologous expression vs. native expression

    • Single-cell vs. population measurements

    • Presence or absence of necessary co-receptors (e.g., Orco)

    • Potential co-expression with ionotropic receptors like Ir25a, which may modify responses

  • Evaluate methodological differences:

    • Temporal resolution and sensitivity of different techniques

    • Potential for artificial activation or inhibition

    • Signal-to-noise ratio of each method

    • Physiological relevance of experimental conditions

  • Perform validation experiments:

    • Test the same odorants across multiple platforms

    • Use positive and negative controls consistently

    • Consider dose-response relationships rather than single-concentration results

    • Verify receptor expression and localization in each system

  • Integrate multiple lines of evidence:

    • Combine functional data with structural information

    • Consider evolutionary conservation of receptor properties

    • Relate in vitro findings to behavioral outcomes

    • Use computational modeling to reconcile disparate datasets

When interpreting results, remember that olfactory neurons might express multiple chemoreceptor families, challenging the traditional view of segregated olfactory receptor expression . Single sensillum recordings from Ir25a mutant sensilla in Orco+ neurons have revealed subtle changes in odor responses, suggesting that multiple chemoreceptor gene families could be involved in the signaling or development of a given OSN class .

How can Or9a research inform comparative studies across Drosophila species?

Research on Or9a can provide valuable insights for comparative studies across Drosophila species:

  • Evolutionary analysis:

    • Compare Or9a sequences across closely related Drosophila species

    • Identify conserved regions that may be functionally critical

    • Detect sites under positive selection that might reflect adaptation to different ecological niches

    • Investigate whether similar co-expression patterns of chemoreceptors exist across species, as has been observed for Orco and Ir25a in Drosophila sechellia

  • Functional comparison:

    • Characterize ligand specificity of Or9a orthologs from different species

    • Correlate functional differences with ecological adaptations

    • Use chimeric receptors to map regions responsible for species-specific responses

  • Behavioral ecology:

    • Compare the behavioral significance of Or9a across species with different host preferences

    • Investigate how Or9a contributes to species-specific behaviors

    • Examine how environmental factors shape the evolution of Or9a function

This comparative approach can provide insights into the molecular basis of olfactory adaptation and speciation, as well as the evolutionary dynamics of chemosensory systems.

What are the prospects for using Or9a as a target for novel insect control strategies?

Understanding Or9a function could inform the development of novel insect control strategies:

  • Odorant-based attractants or repellents:

    • Design compounds that specifically target Or9a

    • Develop attractants for trapping or repellents for protection

    • Create cocktails of odorants targeting multiple receptors including Or9a

  • Genetic control approaches:

    • Utilize knowledge of Or9a genetics for gene drive systems

    • Engineer modifications that alter olfactory preferences

    • Design systems that target Or9a expression or function

  • Comparative analysis across insect orders:

    • Investigate whether Or9a has functional homologs in disease vectors or agricultural pests

    • Assess the conservation of ligand specificity across species

    • Develop species-specific interventions based on receptor differences

When considering these applications, it's important to evaluate potential ecological impacts and to design highly specific approaches that minimize effects on non-target species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.