Recombinant Drosophila melanogaster Putative peroxisome assembly protein 12 (pex12)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Drosophila melanogaster Putative Peroxisome Assembly Protein 12 (Pex12) is a protein involved in peroxisome biogenesis and protein import into peroxisomes . It is a component of the peroxisomal importomer complex .

Drosophila melanogaster is a valuable model organism for studying peroxisomes and peroxisome biogenesis disorders (PBDs) . Peroxisomes are essential organelles responsible for various biochemical processes, including lipid metabolism and detoxification using reactive oxygen species . Studies in Drosophila have demonstrated the high conservation of peroxisomal biogenesis machinery between flies and humans .

Functional Aspects

Pex12 is required for the import of proteins into peroxisomes and is involved in peroxisome biogenesis . In mammalian cells, Pex12, along with Pex2 and Pex10, creates a pore through which enzymes are imported into the peroxisome matrix . Pex5 recognizes and carries cargo through this importomer complex .

Pex Genes and Peroxisome Assembly

The Drosophila genome contains fifteen predicted Pex genes, thirteen of which are homologous to known human PEX genes . Mutations in PEX genes typically result in the mislocalization of peroxisomal matrix proteins to the cytosol, a characteristic feature of PBDs . RNAi knockdown of Pex genes in Drosophila S2 cells has demonstrated that the majority of these genes are required for normal peroxisome assembly . Knockdown of Pex1, Pex2, Pex3, Pex6, Pex12, Pex13, Pex14, or Pex16 reduces or eliminates the punctate structures characteristic of peroxisomes, leading to mislocalization of a GFP-SKL reporter to the cytosol .

Studies in Drosophila

Drosophila models have been used to study the effects of Pex mutations on lipid metabolism, muscle function, and spermatogenesis . Mutations in Drosophila Pex1 correlate with defects during early development, showing abnormalities analogous to those seen in Zellweger syndrome patients, including developmental delay, poor feeding, severe structural abnormalities in the peripheral and central nervous systems, and early death . Transcriptomic data reveals alterations in the expression of genes involved in chitin metabolism and puparial adhesion, suggesting a role for peroxisomes in complex polysaccharide metabolic pathways or changes in the secretory pathway due to dysregulation and loss of peroxisome function .

Recombinant Protein Details

FeatureDescription
Product TypeRecombinant Protein
Sourcein vitro E. coli expression system
Tag InfoThe tag type is determined during the production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
FunctionRequired for protein import into peroxisomes. Involved in peroxisome biogenesis .
Gene InformationGene Name: pex12 ORF Names: CG3639 KEGG: dme:Dmel_CG3639 STRING: 7227.FBpp0305188 UniGene: Dm.23832

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pex12; CG3639; Peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Pex12
Target Protein Sequence
MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELS PLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLR TRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPP KEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQ RGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes and involved in peroxisome biogenesis.
Database Links

KEGG: dme:Dmel_CG3639

STRING: 7227.FBpp0305188

UniGene: Dm.23832

Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the role of Pex12 in Drosophila peroxisome biogenesis?

Pex12 is a critical component of the peroxisome assembly machinery in Drosophila melanogaster. As demonstrated through systematic RNAi analysis in S2 cells, Pex12 knockdown reduces or eliminates punctate structures characteristic of peroxisomes and causes mislocalization of peroxisomal matrix proteins (GFP-SKL reporter) to the cytosol . Pex12 functions as part of the protein import machinery that facilitates translocation of matrix proteins into the peroxisome lumen. This function appears to be evolutionarily conserved across species, including humans, where PEX12 mutations cause peroxisomal biogenesis disorders .

How conserved is Pex12 across species from Drosophila to humans?

Drosophila Pex12 shows significant functional conservation with its human ortholog. Both proteins are integral to peroxisome membrane and participate in matrix protein import. The research indicates that at least 13 of the 14 known Drosophila Pex genes, including Pex12, are required for peroxisome assembly, demonstrating functional conservation with human PEX genes . The conserved role is further supported by the fact that mutations in both human PEX12 and Drosophila Pex12 result in peroxisomal biogenesis defects, though the severity of phenotypes may vary depending on the nature of the mutation and the affected domain .

What developmental processes in Drosophila require functional Pex12?

Functional Pex12, as part of the peroxisome biogenesis machinery, is critical for multiple developmental processes in Drosophila. While the search results do not specifically address Pex12's developmental roles, studies of other Pex gene mutations (like Pex1) reveal requirements for proper nervous system development, with mutants showing severe malformations in both central and peripheral nervous systems . Additionally, peroxisomal function is implicated in neuronal development, innate immunity, lipid and protein metabolism, and gamete formation as revealed by microarray analysis of Pex1 mutants . Given the functional relationships between Pex proteins, Pex12 likely contributes to these developmental processes through its role in peroxisome assembly.

What RNA interference methods are most effective for studying Pex12 function in Drosophila?

For effective RNAi-mediated knockdown of Pex12 in Drosophila, researchers should consider the following approach based on successful protocols:

  • Cell culture model: Use embryonically derived Schneider 2 (S2) cells expressing a peroxisomal marker such as GFP-SKL (a chimeric reporter with the peroxisome targeting signal 1) .

  • dsRNA design: Create double-stranded RNA targeting specific regions of the Pex12 transcript. Researchers successfully used dsRNA targeting Pex12 to reduce peroxisome assembly in S2 cells .

  • Verification methods: Confirm knockdown efficiency using:

    • Semi-quantitative reverse-transcriptase PCR (RT-PCR) to measure mRNA reduction

    • Immunoblotting with antibodies against Pex12 protein (similar to the verification performed for Pex1)

  • Phenotypic analysis: Assess peroxisome assembly by monitoring:

    • Localization of GFP-SKL reporter (punctate pattern indicates normal peroxisomes, diffuse cytosolic pattern indicates defective assembly)

    • Additional peroxisomal markers can be used to confirm the phenotype

How can I establish a reliable Drosophila model for studying Pex12-related peroxisomal disorders?

To establish a reliable Drosophila model for Pex12-related peroxisomal disorders:

  • Generate Pex12 mutant lines:

    • Use P-element insertion, CRISPR-Cas9, or X-ray induced mutations targeting the Pex12 locus

    • Confirm mutations by sequencing and expression analysis

    • Verify that adjacent genes are not affected (as demonstrated in the Pex1 model, where researchers confirmed the breathless gene was not affected)

  • Validate the model:

    • Perform rescue experiments using UAS-Pex12 transgene and appropriate GAL4 drivers

    • Confirm peroxisomal defects through biochemical and cellular assays

  • Characterize phenotypes:

    • Examine developmental abnormalities, particularly in the nervous system

    • Assess glial cell organization, as glial cells provide support and insulation to axons similarly to myelination in mammals

    • Analyze Malpighian tubules (analogous to mammalian kidneys), which show malformations in Pex1 mutants

  • Perform transcriptomic profiling:

    • Use microarray or RNA-seq to identify genes with altered expression in Pex12 mutants

    • Compare gene expression profiles with those of human patients when possible

What reporter systems effectively visualize peroxisome assembly defects in Pex12-deficient cells?

The most effective reporter system for visualizing peroxisome assembly defects in Pex12-deficient cells is:

  • GFP-SKL chimeric reporter protein:

    • This fusion protein contains green fluorescent protein tagged with the evolutionarily conserved C-terminal peroxisome targeting signal 1 (PTS1)

    • In normal cells, GFP-SKL localizes specifically to peroxisomes, producing a characteristic punctate pattern under fluorescence microscopy

    • In Pex12-deficient cells, GFP-SKL shows cytosolic localization, indicating defective peroxisome assembly

  • Additional reporters for comprehensive analysis:

    • PTS2-tagged reporters to assess PTS2-dependent import pathway

    • Peroxisomal membrane protein markers (e.g., PMP70-GFP) to distinguish between matrix protein import defects and membrane assembly defects

  • Catalase immunofluorescence:

    • Catalase is an endogenous peroxisomal enzyme that can be visualized by immunofluorescence

    • Used clinically to assess peroxisome function in fibroblasts from patients with peroxisomal biogenesis disorders

    • Can reveal mosaicism in cells with mild mutations

How does temperature affect the phenotypic manifestation of Pex12 mutations?

Temperature can significantly influence the phenotypic manifestation of Pex peroxisomal protein mutations. In clinical studies of human cells with PEX12 mutations:

  • Temperature sensitivity: Some PEX12 mutations show temperature-dependent effects on peroxisome assembly.

  • Mosaicism persistence: In human fibroblasts with a mild PEX12 mutation (c.102A>T; p.R34S), catalase immunofluorescence showed mosaicism (some cells with normal peroxisomes, others with defects) that persisted even when incubation temperature was increased from 37°C to 40°C. This contrasts with other peroxisomal disorders where higher temperature typically abolishes mosaicism by exacerbating peroxisomal dysfunction .

  • Experimental considerations for Drosophila:

    • When studying Drosophila Pex12 mutations, researchers should test phenotypes at multiple temperatures

    • Temperature shifts could be used as a tool to modulate phenotypic severity

    • The relationship between temperature sensitivity and specific domains of Pex12 could reveal functional insights about protein stability and interactions

What is the relationship between Pex12 mutations and transcriptomic changes in Drosophila?

While the search results don't specifically address transcriptomic changes in Pex12 mutants, research on Pex1 mutants provides insight into likely transcriptomic effects of Pex12 dysfunction:

  • Gene expression clusters:

    • Microarray analysis of Pex1 mutant larvae revealed several clusters of genes with significantly altered expression compared to wild-type

    • These changes implicated peroxisomal function in neuronal development, innate immunity, lipid and protein metabolism, gamete formation, and meiosis

  • Research approach for Pex12:

    • Perform RNA-seq or microarray analysis comparing wild-type and Pex12 mutant Drosophila

    • Focus analysis on developmental timepoints when peroxisome function is critical

    • Compare transcriptomic profiles between different Pex mutants to identify Pex12-specific effects versus general peroxisomal deficiency effects

  • Applications:

    • Transcriptomic profiling could serve as a method to monitor disease progression

    • Gene expression signatures could be used to screen therapeutic drug candidates

    • Comparing transcriptomic changes across different Pex mutants could reveal functional relationships between different peroxins

How do Pex12 mutations affect different tissues during Drosophila development?

Based on studies of peroxisomal biogenesis disorders and Pex gene functions in Drosophila:

  • Nervous system effects:

    • Pex mutations cause severe structural abnormalities in both peripheral and central nervous systems during embryonic development

    • Disorganized glial cells, which provide support and insulation to axons similar to myelination in mammals

    • Loss of and/or mislocalization of axons and neurons

  • Excretory system:

    • Malformed Malpighian tubules (analogous to mammalian kidneys)

    • This parallels kidney abnormalities seen in human Zellweger syndrome patients

  • General developmental effects:

    • Developmental delay

    • Poor feeding and movement coordination

    • Reduced body size

    • Early death

  • Tissue-specific research approach:

    • Use tissue-specific GAL4 drivers with UAS-RNAi constructs targeting Pex12

    • Compare phenotypes across tissues to identify differential sensitivity to peroxisome dysfunction

    • Apply tissue-specific rescue to determine which tissues require Pex12 function for organismal survival

What expression systems are most suitable for producing recombinant Drosophila Pex12?

For optimal expression of recombinant Drosophila Pex12:

  • Insect cell expression systems:

    • Schneider 2 (S2) cells - derived from Drosophila embryos, provide a homologous expression environment

    • Sf9 or High Five cells (derived from Spodoptera frugiperda) - higher protein yield than S2 cells

    • Use vectors with metallothionein or actin promoters for inducible or constitutive expression, respectively

  • Expression considerations:

    • Include appropriate epitope tags (His, FLAG, etc.) for purification and detection

    • Consider expressing only soluble domains if the full-length protein (which contains transmembrane domains) proves difficult to express

    • The N-terminal region of PEX12 is important for localization to peroxisomes

  • Mammalian cell systems:

    • HEK293 or CHO cells can be used if post-translational modifications are important

    • Useful for functional complementation studies with human cells harboring PEX12 mutations

  • In vivo Drosophila expression:

    • UAS-Pex12 transgenic flies with appropriate GAL4 drivers for tissue-specific expression

    • This approach was successful for Pex1 rescue experiments

How can I validate that recombinant Pex12 is functionally active?

To validate the functional activity of recombinant Drosophila Pex12:

  • Complementation assays:

    • Transfect recombinant Pex12 into Pex12-deficient cells (either Drosophila S2 cells with Pex12 knockdown or human fibroblasts from PEX12-deficient patients)

    • Assess restoration of peroxisome assembly using GFP-SKL localization or catalase immunofluorescence

    • This approach was successfully used to confirm PEX12 defects in patient fibroblasts

  • Biochemical interaction assays:

    • Perform co-immunoprecipitation to verify interactions with known Pex12 binding partners

    • Assess ubiquitination activity, as human PEX12 has E3 ligase activity

  • Peroxisomal function tests:

    • Measure restoration of peroxisomal metabolic functions:

      • Very long-chain fatty acid metabolism

      • Bile acid precursor processing

      • Plasmalogen synthesis

  • In vivo rescue:

    • Generate transgenic flies expressing recombinant Pex12 under UAS control

    • Cross with Pex12 mutant flies and appropriate GAL4 driver lines

    • Assess rescue of developmental phenotypes and survival

What analytical techniques can assess peroxisome assembly in Drosophila Pex12 studies?

For comprehensive assessment of peroxisome assembly in Drosophila Pex12 studies:

  • Microscopy techniques:

    • Fluorescence microscopy with GFP-SKL reporter to visualize peroxisome number and morphology

    • Immunofluorescence for endogenous peroxisomal proteins (e.g., catalase)

    • Electron microscopy to examine ultrastructural features of peroxisomes

  • Biochemical assays:

    • Subcellular fractionation to isolate peroxisome-enriched fractions

    • Immunoblotting of fractions to detect peroxisomal matrix and membrane proteins

    • Enzyme activity assays for peroxisomal enzymes (catalase, acyl-CoA oxidase)

  • Metabolite analysis:

    • Measurement of very long-chain fatty acids (VLCFAs) using gas chromatography-mass spectrometry

    • Analysis of bile acid precursors and plasmalogens

    • These metabolites are typically elevated in plasma of patients with peroxisomal disorders

  • Molecular techniques:

    • RT-PCR and immunoblotting to confirm knockdown or mutation of Pex12

    • Microarray or RNA-seq to identify transcriptomic changes associated with peroxisome dysfunction

How do phenotypes of Drosophila Pex12 mutants compare with human PEX12-related disorders?

Comparing Drosophila Pex mutant phenotypes with human PEX12-related disorders reveals important parallels:

  • Neurological manifestations:

    • Human: Motor and cognitive neurological dysfunction, demyelinated axons in CNS and PNS

    • Drosophila: Severe malformations of nervous system, loss/mislocalization of axons and neurons, disorganized glial cells

  • Developmental features:

    • Human: Developmental delay, craniofacial dysmorphism, skeletal defects

    • Drosophila: Developmental delay, smaller size than wild-type counterparts

  • Organ abnormalities:

    • Human: Liver disease, kidney structural abnormalities

    • Drosophila: Malformed Malpighian tubules (analogous to mammalian kidneys)

  • Sensory defects:

    • Human: Sensorineural deafness and retinopathy

    • Drosophila: Not specifically reported in the search results, but could be investigated

  • Biochemical similarities:

    • Both show defects in peroxisome assembly and matrix protein import

    • Both exhibit metabolic abnormalities consistent with peroxisomal dysfunction

What genetic interaction studies can reveal Pex12's role in the peroxisome assembly pathway?

Genetic interaction studies to elucidate Pex12's role in peroxisome assembly:

  • Double mutant/knockdown analysis:

    • Generate flies with combinations of mutations/knockdowns in Pex12 and other Pex genes

    • Assess whether phenotypes show enhancement (synergy) or suppression, indicating parallel or sequential functions

    • Focus on interactions with components known to function with PEX12 in other species (e.g., PEX5, PEX10, PEX2)

  • Suppressor/enhancer screens:

    • Use Pex12 hypomorphic mutants (partial loss of function) for genetic screens

    • Identify mutations that enhance or suppress Pex12 phenotypes

    • This approach could reveal novel components of the peroxisome assembly pathway

  • Epistasis analysis:

    • Determine the order of function of different peroxins by analyzing double mutants

    • If mutation A masks the effects of mutation B in double mutants, protein A likely acts downstream of protein B

  • Protein-protein interactions:

    • Complement genetic studies with biochemical approaches (co-immunoprecipitation, proximity labeling)

    • Validate interactions identified genetically

    • Compare interactome with that of human PEX12 to identify conserved and divergent aspects

How can transcriptomic data from Pex12 mutants inform therapeutic approaches?

Transcriptomic data from Pex12 mutants can guide therapeutic development through:

  • Identification of biomarkers:

    • Gene expression signatures specific to Pex12 dysfunction

    • Potential biomarkers for disease progression and response to therapy

  • Therapeutic screening tool:

    • Transcriptomic profiling provides a tractable method to monitor disease progression

    • Can serve as a tool for screening novel therapeutic drug candidates

    • Treatments that return gene expression profiles to normal levels may be promising candidates

  • Pathway identification:

    • Reveals cellular pathways most affected by peroxisome dysfunction

    • Identifies potential therapeutic targets beyond direct Pex12 replacement

  • Comparative analysis:

    • Compare transcriptomic changes across different Pex gene mutations

    • Identify common downstream effects that could be targeted regardless of the specific PEX gene mutated

    • This approach could aid in developing treatments applicable to multiple peroxisomal biogenesis disorders

  • Personalized medicine approach:

    • Different PEX12 mutations may affect distinct molecular pathways

    • Tailoring treatments based on specific transcriptomic signatures could improve outcomes

Transcriptomic profiling could significantly accelerate therapeutic development by providing an efficient way to identify treatments that correct the molecular consequences of Pex12 dysfunction, potentially offering advantages over current approaches that require extensive biochemical verification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.