Recombinant Drosophila melanogaster Serine protease HTRA2, mitochondrial (HtrA2)

Shipped with Ice Packs
In Stock

Description

Introduction

Mitochondrial high-temperature requirement protease A2 (HtrA2), also known as Omi, is a serine protease that is evolutionarily conserved from prokaryotes to humans . It belongs to the HtrA family of proteases and is involved in various cellular processes, displaying both pro-apoptotic and cell-protective properties . Drosophila melanogaster HtrA2 shares functional similarities with its mammalian counterparts, particularly in maintaining mitochondrial integrity .

Functional Aspects

HtrA2 exhibits both pro-apoptotic and cell-protective functions. Drosophila HtrA2 mutants display phenotypic similarities with parkin and PINK1 mutants, suggesting a role in maintaining mitochondrial integrity .

Key functions of HtrA2 include:

  • Protease Activity: Drosophila HtrA2 demonstrates substrate specificity similar to its mammalian homolog, efficiently cleaving the H2-Opt substrate .

  • Mitochondrial Integrity: HtrA2 is involved in maintaining mitochondrial integrity and protecting cells against oxidative stress .

  • Apoptosis: Contrary to some reports, Drosophila HtrA2 is not required for developmental or stress-induced apoptosis .

Role in Neurodegenerative Disorders

HtrA2 has been linked to neurodegenerative disorders, with studies showing that loss of HtrA2 can lead to mitochondrial dysfunction and increased sensitivity to stress . In murine models, loss of HtrA2 results in compromised mitochondrial respiration, accumulation of peroxidized lipids, and unfolded proteins .

Mechanism of Action

HtrA2 functions through multiple mechanisms, including its serine protease activity and its interactions with other proteins . The PDZ domain of HtrA2 can interact with the serine protease domain of an adjacent monomer, leading to dynamic enzymatic regulation . Mature HtrA2 exposes an N-terminal tetrapeptide motif (AVPS) that binds to Inhibitor of Apoptosis Proteins (IAPs), promoting apoptosis by preventing IAPs from inhibiting caspases .

HtrA2 in Mitochondrial Quality Control

HtrA2 plays a crucial role in mitochondrial quality control by maintaining mitochondrial integrity and clearing unfolded proteins . Loss of HtrA2 can lead to a build-up of oxidative damage and impaired respiratory processes . Additionally, HtrA2 has been found to interact with other proteins involved in mitochondrial function, such as DmLRPPRC2, which is involved in coordinating mitochondrial translation .

Therapeutic Potential

Given its involvement in apoptosis, neurodegenerative disorders, and cancer, HtrA2 is a potential therapeutic target . Its unique structural attributes and multitasking potential make it a promising molecule for therapeutic intervention .

Table 2: Functions of HtrA2

FunctionDescription
Protease ActivityCleaves substrates with a preference for aliphatic Val or Ile in the P1 position
Mitochondrial IntegrityMaintains mitochondrial integrity and protects against oxidative stress
ApoptosisPromotes apoptosis by binding to IAPs and preventing their inhibition of caspases
Regulation of Stress ResponseInfluences the transcription of genes involved in stress response

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HtrA2; Omi/HtrA2; CG8464; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2; DmHtrA2; HtrA2; Omi stress-regulated endoprotease; dOmi
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
94-422
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Target Protein Sequence
SKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLIL TNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRS GEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNL DGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLT PDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD ALADNSKTLDIVILRGVKQMHVTITPEDP
Uniprot No.

Target Background

Function
Recombinant Drosophila melanogaster Serine protease HTRA2, mitochondrial (HtrA2) is a serine protease exhibiting proteolytic activity against the nonspecific substrate beta-casein. It promotes or induces cell death through two mechanisms: direct binding and inhibition of BIRC proteins (Inhibitor of Apoptosis Proteins, IAPs), resulting in increased caspase activity; or through a BIRC-independent, caspase-independent mechanism reliant on serine protease activity. It can antagonize the anti-apoptotic activity of IAPs by directly inducing their degradation.
Gene References Into Functions
  1. Mitochondrial serine protease HtrA2/Omi is a key mediator of germ cell death. PMID: 23523076
  2. Drosophila Omi (dOmi), a Drosophila homolog of Omi/HtrA2, mitigates IAP/DIAP1 inhibition of caspases by proteolytically degrading IAP/DIAP1, inducing apoptosis in cultured cells and developing fly eyes. PMID: 17557079
  3. HtrA2 exhibits PINK1-dependent phosphorylation, suggesting a role in the PINK1 pathway. PMID: 19282869
Database Links

KEGG: dme:Dmel_CG8464

STRING: 7227.FBpp0303078

UniGene: Dm.5609

Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Drosophila HtrA2?

Drosophila HtrA2, encoded by the CG8464 gene, is a mitochondrial serine protease of approximately 46 kDa that contains several conserved domains:

  • N-terminal mitochondrial targeting sequence (MTS)

  • Trans-membrane domain (TM)

  • Central protease domain

  • C-terminal PDZ domain

  • Unconventional IAP-binding motif

Upon import into mitochondria, HtrA2 undergoes proteolytic processing resulting in two cleaved products of 37 and 35 kDa . Functionally, HtrA2 exhibits serine protease activity and can cleave specific peptide substrates similar to its mammalian homologue . When isolated and purified, Drosophila HtrA2 efficiently cleaves the H2-Opt substrate but not control peptides, indicating conserved substrate specificity .

How does HtrA2 contribute to Parkinson's disease pathophysiology?

HtrA2 has been genetically linked to Parkinson's disease (designated as PARK13) through the identification of mutations that lead to loss of protease activity in patient populations . The Drosophila model of HtrA2 deficiency exhibits several PD-like phenotypes:

PhenotypeDescriptionReference
Locomotor defectsImpaired climbing ability and flight
Lifespan reductionShortened longevity compared to controls
Mitochondrial abnormalitiesMild mitochondrial morphological defects
Sensitivity to stressorsIncreased vulnerability to oxidative stress and mitochondrial toxins
Male infertilitySimilar to other PD models like PINK1 mutants

Importantly, HtrA2 appears to function in a pathway downstream of PINK1 but parallel to Parkin, suggesting it plays a distinct role in mitochondrial quality control mechanisms that are disrupted in PD .

How can I effectively express and analyze recombinant Drosophila HtrA2?

For recombinant expression of Drosophila HtrA2, E. coli expression systems have proven effective. The human version can be expressed as Ala134-Glu458 with a C-terminal 6-His tag , and a similar approach can be applied to the Drosophila ortholog:

Expression Protocol:

  • Clone the Drosophila HtrA2 sequence (minus MTS) into a bacterial expression vector with His-tag

  • Transform into E. coli expression strain

  • Induce protein expression and purify using Ni-NTA chromatography

  • Filter solution (0.2 μm) and store in buffer containing HEPES, NaCl, DTT, and glycerol

For storage stability, avoid repeated freeze-thaw cycles and store purified protein at -80°C .

What assays can be used to measure HtrA2 protease activity?

HtrA2 enzymatic activity can be assessed using fluorogenic peptide substrates. The specificity of Drosophila HtrA2 has been demonstrated using the H2-Opt substrate, which is efficiently cleaved compared to control peptides .

Activity Assay Protocol:

  • Prepare reaction buffer (typically containing HEPES and NaCl)

  • Add purified recombinant HtrA2 (5-50 nM concentration)

  • Add fluorogenic peptide substrate H2-Opt (10-50 μM)

  • Monitor increase in fluorescence over time using appropriate excitation/emission wavelengths

  • Calculate enzymatic activity as relative fluorescence units (RFU) per minute

Control experiments should include heat-inactivated enzyme and non-specific peptide substrates to confirm specificity .

How can I generate and characterize HtrA2 mutant Drosophila models?

Several approaches have been successfully used to generate HtrA2-deficient Drosophila models:

  • Precise Excision Mutants: HtrA2Δ1 mutants have been generated through excision of P-element insertions, creating null alleles that can be confirmed by genomic PCR, RT-PCR, and western blot analysis .

  • RNA Interference: Knockdown of HtrA2 can be achieved using UAS-RNAi lines expressed with tissue-specific GAL4 drivers. When expressed in dopaminergic neurons, HtrA2 knockdown produces PD-like phenotypes including shortened lifespan and impaired climbing ability .

  • Tissue-Specific Expression: The GAL4-UAS system can be used to express wild-type or mutant HtrA2 constructs in specific tissues:

    • TH-GAL4 for dopaminergic neuron expression

    • GMR-GAL4 for eye expression

    • MHC-GAL4 for muscle expression

For phenotypic characterization, the following assays are commonly used:

  • Climbing assays to assess locomotor ability

  • Lifespan analysis

  • Toluidine Blue staining of indirect flight muscles (IFMs)

  • Immunostaining for dopaminergic neurons

  • Scanning electron microscopy for eye phenotypes

What is the relationship between HtrA2 and other PD-related genes?

Research has established functional connections between HtrA2 and other Parkinson's disease-related genes:

GeneRelationship with HtrA2EvidenceReference
PINK1HtrA2 acts downstream of PINK1HtrA2 is phosphorylated in a PINK1-dependent manner
ParkinHtrA2 functions in a pathway parallel to ParkinGenetic interaction studies and double-mutant analysis
BuffyOverexpression of Buffy rescues HtrA2 loss-of-function phenotypesSuppression of shortened lifespan, locomotor defects, and eye abnormalities

Genetic epistasis experiments suggest that while HtrA2 acts in the PINK1 pathway, it diverges from the PINK1-Parkin axis, pointing to multiple parallel branches of mitochondrial quality control mechanisms .

How can I distinguish between HtrA2's apoptotic and non-apoptotic functions?

Despite previous reports suggesting HtrA2 is a pro-apoptotic factor, evidence from Drosophila models indicates it is dispensable for both developmental and stress-induced apoptosis . To differentiate between its apoptotic and non-apoptotic roles:

Methodological Approach:

  • Apoptosis Induction: Expose HtrA2 mutant and control tissues to multiple apoptotic stimuli:

    • γ-rays (4Gy)

    • Staurosporine (4μM)

    • Ultraviolet light (2.5 kJ/m²)

  • Apoptosis Detection:

    • Immunostaining for cleaved Caspase-3

    • TUNEL assay

    • Acridine orange staining

  • Mitochondrial Function Assessment:

    • Mitochondrial morphology analysis

    • Membrane potential measurement

    • Reactive oxygen species detection

    • Respiration analysis using Seahorse or similar platforms

Results from HtrA2 mutant Drosophila showed normal apoptosis induction following various stimuli, suggesting its primary function lies in maintaining mitochondrial integrity rather than promoting cell death .

What biochemical approaches can be used to identify HtrA2 substrates and interaction partners?

Understanding HtrA2's molecular function requires identification of its substrates and protein interactors:

Substrate Identification:

  • Proteomics Approach:

    • Compare protein profiles of wild-type and HtrA2-deficient mitochondria

    • Look for accumulated proteins in HtrA2 mutants that may represent potential substrates

    • Validate using in vitro cleavage assays with recombinant HtrA2

  • Candidate Approach:

    • Test known substrates of human HtrA2/Omi

    • Assess potential IAP family proteins (like DIAP1)

    • Examine mitochondrial quality control proteins

Interaction Partners:

  • Co-immunoprecipitation of tagged HtrA2 followed by mass spectrometry

  • Yeast two-hybrid screening

  • Proximity labeling techniques (BioID or APEX) with HtrA2 as the bait protein

Research has demonstrated that HtrA2 forms a complex with PINK1 and is phosphorylated in a PINK1-dependent manner in response to p38 SAPK pathway activation , illustrating how these approaches can reveal functional relationships.

Why might I observe variable phenotypes in HtrA2-deficient models?

Variability in HtrA2 mutant phenotypes has been reported across different studies. Potential causes and solutions include:

Variable FactorImpactSolution
Genetic backgroundModifier genes can enhance or suppress phenotypesUse precise excision controls from same background
Environmental conditionsTemperature, diet, and stress affect phenotype penetranceStandardize housing conditions and implement stress protocols
Age of analysisHtrA2 phenotypes are often progressivePerform time-course experiments with age-matched controls
Allelic differencesDifferent mutations may affect protein function differentlyCompare multiple alleles and confirm protein levels
Tissue-specific effectsHtrA2 function may vary between tissuesUse tissue-specific drivers and compare phenotypes

For example, one study noted that while they observed mild mitochondrial defects in HtrA2 mutants, another group did not report such defects, possibly due to "allelic or environmental differences" .

How can I optimize experimental conditions for studying stress responses in HtrA2 models?

HtrA2 mutants show increased sensitivity to oxidative stress and mitochondrial toxins . To optimize stress response studies:

Recommended Approach:

  • Dose Titration: Determine optimal concentrations of stressors that discriminate between wild-type and HtrA2-deficient flies:

    • Paraquat (oxidative stress inducer)

    • Rotenone (complex I inhibitor)

    • Antimycin A (complex III inhibitor)

    • H₂O₂ (direct oxidative agent)

  • Timing: Assess both acute and chronic stress responses:

    • Acute: High dose, short-term exposure (hours)

    • Chronic: Low dose, long-term exposure (days)

  • Readouts: Implement multiple phenotypic readouts:

    • Survival curves

    • Locomotor performance

    • ATP levels

    • Mitochondrial morphology

    • ROS production

    • Protein carbonylation

  • Rescue Experiments: Test whether overexpression of protective factors like Buffy can suppress stress sensitivity in HtrA2-deficient models

When designing these experiments, include appropriate genetic controls and consider age-dependent effects, as older flies may show enhanced sensitivity to stress challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.