Recombinant Drosophila melanogaster Signal peptidase complex subunit 1 (Spase12)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Biological Role

Spase12 (Gene ID: 50096) is a 12 kDa subunit of the signal peptidase complex (SPC) in Drosophila melanogaster. The SPC cleaves signal peptides from nascent secretory and transmembrane proteins entering the endoplasmic reticulum (ER), enabling proper protein localization . Unlike its yeast homolog Spc1p, Spase12 is essential for viability in Drosophila, with null alleles causing embryonic lethality and tissue-specific developmental defects .

Key Gene Information

PropertyDetails
Gene SymbolSpase12 (CG11500, CG31042)
OrganismDrosophila melanogaster (fruit fly)
Gene TypeProtein-coding
Chromosomal Location3R (NT_033777.3)
Functional AnnotationSignal peptidase activity, ER protein processing, developmental regulation

Functional Insights from Mutational Studies

Loss-of-function (LOF) mutations in spase12 disrupt development in Drosophila, as demonstrated by:

  • Developmental Defects: Mosaic tissues exhibit disorganized ommatidia (eye units), ectopic bristles, and aberrant cell differentiation .

  • Immune Activation: Melanotic mass formation in mutant tissues suggests Spase12 LOF triggers immune responses .

  • Apoptosis: Increased caspase activity and retinal degeneration in mutant eyes .

These phenotypes highlight Spase12’s role in maintaining ER function and tissue homeostasis. Unlike yeast Spc1p, Spase12 is indispensable in metazoans, potentially due to its interactions with ribosomal subunits and translocon components .

Research Tools and Antibodies

  • Rabbit Anti-Spase12 Antibody: Used for Western blot and ELISA, validated for specificity in Drosophila lysates .

  • Genomic Rescue Constructs: A 29 kb genomic fragment (spase12 GR) rescues LOF phenotypes, confirming functional equivalence to native Spase12 .

Applications in Protein Trafficking Research

Recombinant Spase12 facilitates:

  • Mechanistic Studies: Investigating SPC substrate specificity and cleavage efficiency.

  • Disease Modeling: Linking ER processing errors to developmental disorders.

  • High-Throughput Screening: Identifying inhibitors or modulators of signal peptidase activity.

Evolutionary and Comparative Insights

Spase12’s homology to human SPC12 (54% sequence similarity) underscores its utility in studying conserved ER translocation pathways . Functional divergence from yeast Spc1p highlights evolutionary adaptations in multicellular organisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Spase12; CG11500; Signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Spase12
Target Protein Sequence
MLDIQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITI PPWPLYRRNALKWQKPIDTDAKSSSSESGDEGKKKKKQ
Uniprot No.

Target Background

Function
Microsomal signal peptidase is a membrane-bound endoproteinase responsible for removing signal peptides from nascent proteins during their translocation into the lumen of the endoplasmic reticulum. It plays a crucial role in infection by flaviviruses such as West Nile virus and Dengue virus type 2.
Gene References Into Functions
  1. Spase12 is an essential gene required for development and cell differentiation in the fruitfly. PMID: 23573290
Database Links

KEGG: dme:Dmel_CG11500

STRING: 7227.FBpp0084801

UniGene: Dm.23053

Protein Families
SPCS1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.