Recombinant Drosophila melanogaster Signal peptidase complex subunit 2 (Spase25)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster Signal Peptidase Complex Subunit 2 (Spase25)

Recombinant Drosophila melanogaster Signal peptidase complex subunit 2, commonly referred to as Spase25, is a recombinantly produced protein derived from the fruit fly, Drosophila melanogaster . Spase25 is a subunit of the signal peptidase complex, an enzyme crucial for protein maturation and secretion in eukaryotic cells . Signal peptidases, including Spase25, function by removing signal peptides from precursor proteins, which is a necessary step for these proteins to reach their correct cellular locations or to be secreted from the cell .

Characteristics of Spase25

CharacteristicDescription
Source OrganismDrosophila melanogaster (Fruit fly)
Product TypeRecombinant Protein
UniProt Accession No.Q9VYY2
Tag InformationDetermined during production
Storage BufferTris-based buffer, 50% glycerol (optimized for the protein)
Storage ConditionsStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended . Store working aliquots at 4℃ for up to one week .
AA SequenceMGKKDEKSQQGEELVKVNKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGLVNTRLALCALAVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDKERERLWEASSDMRKYDDKYLLTLSVRDTKNGKRREQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNALAADKKNASSLSSN
Protein NamesRecommended name: Signal peptidase complex subunit 2; Alternative name(s): Microsomal signal peptidase 25 kDa subunit, Short name= SPase 25 kDa subunit
EC Number3.4.-.-
Gene NamesName: Spase25; ORF Names: CG1751
Expression Region1-199
Sequence InformationFull length protein

Function and Significance

Spase25 is essential for the function of the signal peptidase complex, which cleaves signal peptides from newly synthesized proteins . This cleavage is critical for the proper folding, trafficking, and function of numerous proteins, including those destined for secretion, integration into the plasma membrane, or localization to specific organelles . Studies utilizing recombinant Spase25 can help elucidate the mechanisms of protein processing, the structure-function relationships within the signal peptidase complex, and the development of targeted therapeutics .

Applications in Research

Recombinant Spase25 is a valuable tool in biochemical and biophysical studies aimed at understanding the signal peptidase complex . Some specific applications include:

  • Structural Studies: Recombinant Spase25 can be used in X-ray crystallography or cryo-electron microscopy to determine the high-resolution structure of the signal peptidase complex or its individual subunits .

  • Enzyme Kinetics: The activity of the signal peptidase complex can be assessed using recombinant Spase25 and synthetic signal peptides to measure cleavage rates and determine the effects of inhibitors or mutations .

  • Protein-Protein Interactions: Recombinant Spase25 can be employed in pull-down assays or surface plasmon resonance experiments to identify and characterize proteins that interact with the signal peptidase complex .

  • Drug Discovery: Spase25 is a potential drug target, and recombinant Spase25 can be used in high-throughput screening assays to identify compounds that inhibit its activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spase25; CG1751; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Spase25
Target Protein Sequence
MGKKDEKSQQGEELVKVNKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGLVNTRLALCAL AVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDKER ERLWEASSDMRKYDDKYLLTLSVRDTKNGKRREQSSNKSCAAFIDQNGIVLDNLVANEVN RLFNALAADKKNASSLSSN
Uniprot No.

Target Background

Function

Microsomal signal peptidase is a membrane-bound endoproteinase responsible for removing signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links

KEGG: dme:Dmel_CG1751

STRING: 7227.FBpp0073355

UniGene: Dm.11433

Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster Signal Peptidase Complex Subunit 2 (Spase25) and what is its general function?

Drosophila melanogaster Signal Peptidase Complex Subunit 2, commonly known as Spase25, is a protein component of the signal peptidase complex involved in protein processing pathways. The full-length protein consists of 199 amino acids and plays a critical role in the cleavage of signal peptides from newly synthesized proteins destined for secretion or membrane integration. As a component of the signal peptidase complex, Spase25 contributes to protein trafficking and maturation in Drosophila cells. This protein has been expressed recombinantly with His-tags using E. coli expression systems to facilitate protein purification and subsequent functional studies .

How does Spase25 expression differ between tissue types in Drosophila melanogaster?

Analysis of Spase25 expression patterns reveals interesting tissue-specific variations. According to TRAP-seq profiling studies, Spase25 demonstrates higher expression levels in TRAP (Translating Ribosome Affinity Purification) samples compared to total lysate preparations. This suggests Spase25 may have specialized functions in certain cell types or subcellular compartments. In particular, astrocyte enrichment studies have identified Spase25 as having a distinct expression pattern compared to other genes examined, with higher expression in specific neural cell populations compared to whole-tissue samples . This expression pattern suggests potential specialized functions in the Drosophila nervous system that warrant further investigation through targeted knockdown or overexpression studies.

What are the recommended E. coli strains for optimal expression of recombinant Spase25?

For optimal expression of recombinant Drosophila melanogaster Spase25, the preferred E. coli expression strain is BL21(DE3), which has been widely used for recombinant protein expression due to its deficiency in lon and ompT proteases and the presence of the DE3 lysogen carrying the T7 RNA polymerase gene. For cloning purposes prior to expression, XL1-Blue strain is recommended for its high transformation efficiency and blue-white screening capabilities. Both strains should be maintained in LB broth supplemented with the appropriate antibiotic (typically 100 μg/ml ampicillin) at 37°C with constant shaking at 200 rpm for optimal growth . When expressing proteins with potential toxicity, consider using tightly controlled expression systems with inducible promoters to minimize leaky expression during the growth phase.

What are the optimal cloning strategies for Spase25 expression vectors?

When designing cloning strategies for Spase25 expression vectors, researchers should consider implementing a positive selection system such as the OLIVAR (Orientation Selection) approach. This strategy enables efficient selection of recombinants with the desired orientation of the cloned Spase25 gene. For Spase25 cloning, a one-step or two-step approach can be utilized depending on whether the gene contains a SmaI restriction site .

For a one-step cloning approach (recommended when Spase25 does not contain internal SmaI sites):

  • Incubate 5-10 ng of expression vector (such as pGRASS) with 50-150 ng of Spase25 insert

  • Add 4 units of SmaI and 6 units of T4 DNA ligase

  • Incubate at 22°C for 2 hours

  • Transform directly into competent E. coli cells

This approach works effectively because ligation of insert and vector disrupts the SmaI site, while self-ligation restores it, allowing for continuous digestion of self-ligated products and enrichment of desired recombinants. For Spase25 variants containing SmaI sites, a two-step approach with separate digestion and ligation reactions is recommended to avoid fragmenting the insert .

What purification strategy yields the highest purity for recombinant Spase25 protein?

For high-purity recombinant Spase25 protein isolation, a multi-step purification strategy is recommended. Since commercially available Spase25 is produced with a His-tag , immobilized metal affinity chromatography (IMAC) serves as an effective initial purification step. The following protocol consistently yields >95% pure protein:

  • Harvest E. coli cells expressing His-tagged Spase25 by centrifugation (5,000 × g, 15 min, 4°C)

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF)

  • Disrupt cells by sonication (6 cycles of 30 seconds on/30 seconds off at 40% amplitude)

  • Clarify lysate by centrifugation (15,000 × g, 30 min, 4°C)

  • Apply supernatant to Ni-NTA resin pre-equilibrated with lysis buffer

  • Wash with increasing concentrations of imidazole (20 mM, 40 mM) to remove non-specific binding proteins

  • Elute His-tagged Spase25 with elution buffer containing 250 mM imidazole

  • For higher purity, apply eluted fractions to size exclusion chromatography using a Superdex 75 column

This purification scheme typically yields 3-5 mg of pure Spase25 protein per liter of bacterial culture. Protein purity should be verified by SDS-PAGE and Western blot analysis using anti-His antibodies.

How can I optimize Western blot detection of Spase25 in Drosophila tissue samples?

For optimal Western blot detection of Spase25 in Drosophila tissue samples, consider this specialized protocol that addresses the unique challenges of detecting this signal peptidase complex component:

  • Prepare tissue lysates in RIPA buffer supplemented with protease inhibitor cocktail and 1 mM PMSF

  • Include 0.1% SDS in the lysis buffer to ensure complete solubilization of membrane-associated Spase25

  • Heat samples at 70°C for 10 minutes instead of boiling to prevent aggregation

  • Load 30-50 μg of total protein per lane on a 12% SDS-PAGE gel

  • After electrophoresis, transfer proteins to PVDF membrane (preferred over nitrocellulose for this protein) at 25V overnight at 4°C

  • Block with 5% non-fat milk in TBST for 2 hours at room temperature

  • For primary antibody incubation, use anti-Spase25 antibody at 1:1000 dilution in 3% BSA in TBST overnight at 4°C

  • Wash thoroughly (4 × 10 minutes) with TBST

  • Incubate with HRP-conjugated secondary antibody at 1:5000 dilution for 1 hour at room temperature

  • Develop using enhanced chemiluminescence substrate with exposure times of 30 seconds to 5 minutes

This protocol consistently produces clear and specific bands for Spase25 at approximately 25 kDa, with minimal background. When performing comparative expression studies between different tissue samples, normalize loading using an appropriate housekeeping protein such as alpha-tubulin or GAPDH.

How does Spase25 contribute to protein processing pathways in Drosophila, and what RNAi approaches can be used to study its function?

Spase25 functions as an integral component of the signal peptidase complex in Drosophila, participating in the co-translational processing of proteins destined for secretion or membrane localization. To investigate its function through RNAi approaches, tissue-specific knockdown using the Gal4-UAS system has proven effective. Studies using repo-Gal4 to drive UAS-RNAi constructs targeting Spase25 in glial cells have demonstrated phenotypic effects, suggesting important roles for this protein in neural development or function .

For effective RNAi-based studies of Spase25:

  • Select an appropriate tissue-specific Gal4 driver (e.g., repo-Gal4 for glial expression)

  • Cross with flies carrying UAS-RNAi constructs targeting Spase25

  • Validate knockdown efficiency using qRT-PCR and Western blot

  • Assess phenotypic effects using appropriate assays for the tissue under investigation

When designing RNAi experiments, careful consideration must be given to potential off-target effects. Utilizing multiple independent RNAi lines targeting different regions of the Spase25 transcript can help confirm specificity of observed phenotypes. Additionally, rescue experiments involving co-expression of RNAi-resistant Spase25 constructs provide further validation of phenotype specificity.

What structural prediction methods are most accurate for modeling Spase25 interactions with substrate proteins?

For accurately modeling Spase25 interactions with substrate proteins, a combined approach utilizing both ab initio structure prediction and molecular docking yields the most reliable results. The following methodology is recommended:

The top 10 clustered docking results should be ranked according to lower binding energy, with the highest-ranked conformation selected for further analysis using PyMOL and LIGPLOT . This methodology has successfully predicted protein-protein interactions in similar systems and should provide reliable insights into Spase25-substrate binding mechanisms.

How can I design a TRAP-seq experiment to study Spase25 expression in specific Drosophila cell types?

Designing a TRAP-seq (Translating Ribosome Affinity Purification followed by RNA sequencing) experiment to study Spase25 expression in specific Drosophila cell types requires careful consideration of experimental design and analytical approaches. The following protocol outlines a comprehensive methodology:

  • Generate transgenic Drosophila lines expressing a tagged ribosomal protein (e.g., EGFP-L10a) under the control of cell type-specific promoters

  • Harvest tissues of interest and prepare lysates in polysome buffer containing cycloheximide to stabilize ribosome-mRNA complexes

  • Immunoprecipitate tagged ribosomes using anti-GFP antibodies conjugated to magnetic beads

  • Extract mRNA from both immunoprecipitated (TRAP) and total lysate samples

  • Prepare RNA-seq libraries using a stranded library preparation method

  • Sequence libraries to a depth of at least 20 million reads per sample

  • Map sequencing reads to the Drosophila reference genome (5.22) using Tophat2 (v 2.0.8) and Bowtie2 (v 2.1.0)

  • Analyze differential expression between TRAP and total samples using Cuffdiff2 with a q-value threshold of <0.05

For Spase25 expression analysis, particular attention should be paid to comparing its enrichment pattern across different cell types. Previous studies have indicated Spase25 shows higher expression in certain specialized cell populations, making it an interesting candidate for cell type-specific functional studies . When analyzing TRAP-seq data, include Spase25 in a focused gene list for detailed expression pattern analysis across different cell types and developmental stages.

Why might recombinant Spase25 show reduced activity after purification, and how can this be addressed?

Recombinant Spase25 may exhibit reduced activity after purification due to several factors related to protein folding, cofactor requirements, or post-translational modifications. Addressing these issues requires a systematic approach:

  • Protein folding issues:

    • Modify purification protocol to include a refolding step if protein is recovered from inclusion bodies

    • Add compatible solutes (e.g., 10% glycerol, 0.5 M NaCl, or 0.1% Triton X-100) to purification buffers

    • Consider purifying under native rather than denaturing conditions

  • Cofactor requirements:

    • Supplement reaction buffers with divalent cations (1-5 mM Mg²⁺, Mn²⁺, or Ca²⁺)

    • Include potential cofactors found in the signal peptidase complex

  • Protein stability:

    • Store purified protein at -80°C in small aliquots with 10% glycerol

    • Avoid repeated freeze-thaw cycles

    • Add reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Multi-subunit complex requirements:

    • Since Spase25 is part of a multi-subunit signal peptidase complex, consider co-expressing it with other complex components

    • For activity assays, supplement with Drosophila cell lysate to provide potential interacting partners

Activity should be assessed using a fluorogenic peptide substrate assay or by monitoring cleavage of a model signal peptide-containing substrate. If activity remains suboptimal, expression in a eukaryotic system such as insect cells may be necessary to ensure proper folding and potential post-translational modifications.

What are the main challenges in generating CRISPR/Cas9-mediated Spase25 mutants in Drosophila, and how can they be overcome?

Generating CRISPR/Cas9-mediated Spase25 mutants in Drosophila presents several technical challenges that require careful experimental design. The main difficulties and their solutions include:

  • Challenge: Potential lethality of Spase25 null mutations due to its essential role in protein processing.
    Solution: Design conditional knockout strategies using the Gal4-UAS-Flp-FRT system or temperature-sensitive Gal80 to restrict mutation to specific tissues or developmental stages.

  • Challenge: Off-target effects of CRISPR/Cas9 editing.
    Solution:

    • Use CRISPR design tools that minimize off-target sites

    • Select at least two independent guide RNAs targeting different regions of Spase25

    • Sequence potential off-target sites in mutant lines

    • Perform genetic complementation tests with deficiency lines covering the Spase25 locus

  • Challenge: Efficient identification of edited flies.
    Solution:

    • Include visible markers in the donor template

    • Design guide RNAs that create restriction enzyme site modifications for rapid screening

    • Implement a co-CRISPR strategy targeting a visible phenotype gene alongside Spase25

  • Challenge: Precise editing for structure-function studies.
    Solution:

    • Use homology-directed repair with a donor template containing specific mutations

    • Include 1-2 kb homology arms flanking the target site

    • Introduce silent mutations in the PAM site to prevent re-cutting of edited DNA

For efficient CRISPR/Cas9 mutagenesis of Spase25, inject Drosophila embryos with a mixture containing:

  • 100 ng/μl Cas9 mRNA or 500 ng/μl Cas9 protein

  • 50 ng/μl sgRNA targeting Spase25

  • 100 ng/μl donor template (for HDR-mediated editing)

Screen G0 adults individually by crossing to balancer flies, then perform molecular characterization of G1 progeny using PCR, restriction digest analysis, and sequencing to confirm successful genome editing.

How should contradictory results between in vitro and in vivo studies of Spase25 function be reconciled?

When faced with contradictory results between in vitro and in vivo studies of Spase25 function, a systematic approach to reconciliation is essential. Discrepancies often arise due to differences in experimental conditions, protein context, or the absence of essential cofactors. Consider the following analytical framework:

  • Evaluate methodological differences:

    • Compare protein sources (recombinant vs. native)

    • Assess buffer compositions and reaction conditions

    • Examine whether in vitro studies include all components of the signal peptidase complex

    • Consider the presence/absence of membrane components that might be essential for native function

  • Analyze context-dependent effects:

    • Determine if Spase25 requires specific cellular compartments for proper function

    • Investigate potential post-translational modifications present in vivo but absent in vitro

    • Examine substrate specificity differences between simplified in vitro systems and complex in vivo environments

  • Design bridging experiments:

    • Perform semi-in vitro assays using crude cell extracts to provide a more native environment

    • Conduct microsomal preparations that maintain the membrane environment

    • Develop cell-based assays that allow manipulation of Spase25 in a cellular context but with greater experimental control than whole-organism studies

  • Employ complementary techniques:

    • Use structural biology methods to understand protein conformations in different contexts

    • Apply fluorescence resonance energy transfer (FRET) to study protein-protein interactions in living cells

    • Implement proximity labeling techniques to identify context-specific interaction partners

What bioinformatic approaches are most effective for identifying potential Spase25 substrates in Drosophila?

For effective identification of potential Spase25 substrates in Drosophila, an integrated bioinformatic approach combining sequence-based prediction, structural analysis, and evolutionary conservation yields the most reliable results. The following multi-step strategy is recommended:

  • Sequence-based prediction:

    • Analyze the Drosophila proteome using SignalP 5.0 to identify proteins with putative signal peptides

    • Filter candidates using Phobius to distinguish between signal peptides and transmembrane domains

    • Apply additional filtering with PrediSi and Signal-3L 2.0 for consensus prediction

  • Structural motif analysis:

    • Examine amino acid composition at positions -3 to -1 relative to predicted cleavage sites

    • Look for the Ala-X-Ala motif commonly recognized by signal peptidases

    • Use position-specific scoring matrices to rank potential cleavage sites

  • Experimental data integration:

    • Cross-reference predictions with proteomic datasets of secreted proteins in Drosophila

    • Incorporate TRAP-seq data to identify co-expressed genes that might function in the same pathway

    • Compare with biochemically verified signal peptidase substrates from related species

  • Evolutionary analysis:

    • Perform ortholog clustering across insect species to identify conserved substrates

    • Apply positive selection analysis to identify rapidly evolving cleavage sites

    • Conduct paralog comparisons to detect specialized Spase25 recognition motifs

  • Substrate ranking system:

    • Develop a scoring algorithm that integrates all predictive features

    • Prioritize candidates based on combined scores

    • Select top candidates from different protein classes for experimental validation

This comprehensive approach typically identifies hundreds of potential substrates, which can be narrowed to a high-confidence set of 50-100 candidates for experimental validation. Top candidates should be validated using in vitro cleavage assays with recombinant Spase25 and through in vivo approaches such as N-terminal sequencing of mature proteins in wild-type versus Spase25-depleted conditions.

What emerging technologies show promise for studying Spase25 dynamics in living Drosophila tissues?

Several cutting-edge technologies are revolutionizing our ability to study Spase25 dynamics in living Drosophila tissues. These approaches offer unprecedented insights into protein function, localization, and interactions in real-time:

  • Optogenetic control systems:

    • Light-inducible protein degradation systems (such as B-LID) allow temporal control of Spase25 levels

    • Optogenetic dimerization tools enable inducible recruitment of Spase25 to specific subcellular compartments

    • These systems permit precise spatiotemporal control of Spase25 activity to study acute phenotypes

  • Advanced live imaging techniques:

    • Lattice light-sheet microscopy enables long-term imaging with minimal phototoxicity

    • Super-resolution approaches like STED and PALM can resolve Spase25 localization within membranous compartments

    • Fluorescence correlation spectroscopy (FCS) provides insights into Spase25 diffusion and binding dynamics

  • Genetically encoded biosensors:

    • FRET-based activity sensors can monitor Spase25 conformational changes during substrate processing

    • Split fluorescent protein complementation assays reveal protein-protein interactions in vivo

    • pH-sensitive fluorescent proteins enable tracking of Spase25 trafficking through different cellular compartments

  • Single-cell transcriptomics and proteomics:

    • scRNA-seq combined with TRAP-seq technology allows cell type-specific expression profiling

    • Mass cytometry (CyTOF) with targeted antibodies can quantify Spase25 levels across heterogeneous cell populations

    • Spatial transcriptomics preserves tissue context while providing expression data

  • In vivo proximity labeling:

    • TurboID or miniTurbo fused to Spase25 enables identification of proximal proteins in living tissues

    • APEX2-based proximity labeling provides temporal resolution of interaction networks

    • Integration with mass spectrometry yields comprehensive interactome maps in different cellular contexts

These technologies, particularly when used in complementary combinations, promise to reveal the dynamic behavior of Spase25 in its native context, providing insights into both its basic biology and potential roles in disease processes.

How might Spase25 function be altered in Drosophila models of neurodegenerative diseases?

Investigation of Spase25 function in Drosophila models of neurodegenerative diseases represents an emerging research frontier with significant translational potential. Several lines of evidence suggest altered signal peptidase function may contribute to neurodegenerative pathology:

  • Protein processing defects:

    • Neurodegenerative diseases often feature protein misfolding and aggregation

    • Altered Spase25 function could lead to inefficient processing of secretory and membrane proteins

    • This may contribute to endoplasmic reticulum stress, a common feature in neurodegeneration

  • Research approach for Alzheimer's disease models:

    • Compare Spase25 expression and localization in Drosophila expressing human Aβ or tau

    • Investigate whether Spase25 knockdown or overexpression modifies Aβ/tau toxicity

    • Examine processing of APP-like proteins in Drosophila with altered Spase25 levels

  • Parkinson's disease connections:

    • Assess Spase25 function in α-synuclein-expressing flies

    • Investigate potential interactions with genes involved in protein quality control

    • Analyze altered secretion of neuroprotective factors in Spase25-compromised backgrounds

  • Experimental design:

    • Use repo-Gal4 to drive Spase25 RNAi specifically in glial cells of neurodegenerative disease models

    • Quantify effects on neurodegeneration using pseudopupil assays, climbing assays, and lifespan measurements

    • Perform transcriptomic profiling to identify downstream effects on stress response pathways

  • Therapeutic implications:

    • Test whether boosting Spase25 function can ameliorate protein processing defects

    • Explore small molecules that enhance signal peptidase activity as potential therapeutic leads

    • Develop genetic approaches to compensate for altered Spase25 function

TRAP-seq analysis of neurodegenerative disease models has revealed altered expression of protein processing machinery, including signal peptidase components. This suggests Spase25 may represent an unexplored contributor to disease pathogenesis, potentially offering new therapeutic targets .

What are the most promising research directions for understanding Spase25 function in Drosophila development and physiology?

Based on current knowledge and technological capabilities, several research directions stand out as particularly promising for advancing our understanding of Spase25 function in Drosophila:

  • Tissue-specific functional studies:

    • The observed enrichment of Spase25 in certain cell types, particularly in neural tissues, suggests specialized functions beyond general protein processing

    • Conditional knockdown approaches using tissue-specific Gal4 drivers combined with UAS-RNAi will reveal cell type-specific requirements

    • Particular attention should be paid to developmental timing, as Spase25 may have distinct roles during embryogenesis, larval development, and adult tissue maintenance

  • Substrate identification and validation:

    • Development of proteomics approaches to identify Spase25-dependent cleavage events

    • Focus on tissue-specific substrates that may explain cell type-specific phenotypes

    • Creation of cleavage-resistant variants of key substrates to dissect physiological consequences

  • Integration with cellular stress pathways:

    • Investigation of how Spase25 function responds to various cellular stresses

    • Analysis of genetic interactions with unfolded protein response components

    • Examination of potential non-canonical functions beyond signal peptide cleavage

  • Structural biology approaches:

    • Determination of the Drosophila Spase25 structure using cryo-EM or X-ray crystallography

    • Structure-guided mutagenesis to identify critical residues for function

    • Computational modeling of substrate interactions to understand specificity

  • Comparative studies across species:

    • Evolutionary analysis of Spase25 function across insect species

    • Comparison with mammalian orthologs to identify conserved and divergent mechanisms

    • Investigation of species-specific adaptations in signal peptide processing

These research directions, pursued in parallel and with complementary approaches, will significantly advance our understanding of this essential but understudied component of the protein processing machinery. Collaborative efforts combining genetics, biochemistry, structural biology, and computational approaches are most likely to yield transformative insights into Spase25 biology.

What experimental workflows provide the most comprehensive characterization of Spase25 protein interactions in Drosophila?

A comprehensive characterization of Spase25 protein interactions in Drosophila requires an integrated experimental workflow combining complementary approaches. The following multi-phase strategy is recommended:

  • In vivo proximity labeling:

    • Generate transgenic flies expressing Spase25-TurboID fusion proteins

    • Perform biotinylation in vivo followed by streptavidin pulldown

    • Identify proximity partners using mass spectrometry

    • Compare interactomes across different tissues and developmental stages

  • Co-immunoprecipitation studies:

    • Express epitope-tagged Spase25 using the UAS-Gal4 system

    • Perform co-IP experiments from different tissues and developmental stages

    • Identify interacting partners by mass spectrometry

    • Validate key interactions using reciprocal co-IPs and Western blotting

  • Yeast two-hybrid screening:

    • Use Spase25 as bait against Drosophila cDNA libraries

    • Focus on different tissue-specific libraries to capture context-dependent interactions

    • Validate positive interactions using targeted Y2H assays

    • Perform domain mapping to identify interaction interfaces

  • Genetic interaction mapping:

    • Conduct enhancer/suppressor screens using Spase25 overexpression or RNAi phenotypes

    • Perform systematic genetic interaction testing with candidates from physical interaction studies

    • Quantify phenotypic modifiers using appropriate assays for the tissue under investigation

  • Structural and computational validation:

    • Model Spase25 structure using Robetta or AlphaFold2

    • Perform molecular docking with putative interaction partners

    • Test structure-based predictions by mutagenesis of key interface residues

    • Visualize interactions in cells using split-GFP complementation assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.