Recombinant Drosophila melanogaster Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Conservation

Drosophila melanogaster Spastin belongs to the AAA (ATPases Associated with diverse cellular Activities) protein family, characterized by a highly conserved ATPase domain that shares 67% sequence identity with the human ortholog . This remarkable conservation extends beyond mere sequence homology to functional equivalence, as demonstrated through cross-species rescue experiments. Studies have conclusively shown that exogenous expression of either wild-type Drosophila or human spastin can rescue behavioral and cellular defects in spastin null flies with equivalent efficacy . This interchangeability validates the use of Drosophila as a model system for studying human Spastin-related disorders and underscores the evolutionary preservation of Spastin's fundamental functions.

Relevance to Human Disease

Mutations in the SPAST gene, which encodes Spastin, represent the most frequent cause of autosomal dominant hereditary spastic paraplegia (AD-HSP) in humans. The Drosophila model recapitulates key aspects of the human condition, with spastin null flies exhibiting striking behavioral similarities to human patients suffering from AD-HSP . These flies demonstrate compromised motor function, walking, climbing, and standing poorly, with legs that frequently slip—symptoms remarkably similar to the mobility impairments observed in human HSP patients . This phenotypic similarity further reinforces the value of Drosophila as a model organism for studying Spastin function and dysfunction.

Protein Domains and Architecture

The Drosophila Spastin protein contains several functionally critical domains that dictate its activity and interactions within cells. Each Spastin monomer comprises:

  1. A carboxyl-terminal AAA ATPase catalytic domain - highly conserved between species and essential for ATP hydrolysis and microtubule severing activity .

  2. A microtubule-interacting and trafficking (MIT) domain - facilitates binding to microtubule polymers and promotes subsequent hexamerization .

These domains work in concert to enable Spastin's primary cellular function: ATP-dependent severing of microtubules along their lengths.

Mechanism of Action

Spastin monomers assemble into hexameric, ring-shaped ATPases that interact with and sever microtubules through a precisely coordinated mechanism . This severing activity is mechanistically distinct from the well-characterized dynamic instability process of microtubule disassembly, which occurs spontaneously only at microtubule ends . Instead, Spastin creates internal breaks along the microtubule lattice through an ATP-dependent process.

The mechanistic sequence of Spastin-mediated microtubule severing involves:

  1. Binding of Spastin monomers to microtubules

  2. Promotion of hexamerization upon substrate binding

  3. ATP hydrolysis by the assembled complex

  4. Mechanical breakage of the microtubule substrate

This severing activity plays a crucial role in microtubule network remodeling, especially in neurons, where proper microtubule dynamics are essential for axonal transport and synaptic function.

ATPase Activity and Microtubule Severing

The ATPase activity of Spastin is indispensable for its microtubule-severing function. Experimental evidence has conclusively demonstrated that recombinant Spastin makes internal breaks along microtubules in both purified in vitro assembled microtubule preparations and permeabilized cell systems . Video microscopy has revealed that when ATP is added to initiate reactions with wild-type Spastin, rapid severing of nearly all microtubules occurs within minutes. In contrast, ATP hydrolysis-deficient mutants (such as E442Q in human Spastin) show no microtubule severing activity even after extended observation periods, confirming that ATP hydrolysis by Spastin is both necessary and sufficient for microtubule severing .

Expression and Purification Systems

Recombinant Drosophila Spastin has been successfully produced using various expression systems for research purposes. Transgenic approaches have utilized UAS-CFP-Spastin and UAS-Venus-Spastin constructs to express fluorescently tagged Spastin variants in Drosophila tissues, enabling visualization of the protein's subcellular distribution in larval epidermal cells and neurons . When expressed in larval epidermal cells, Drosophila Spastin localizes diffusely in the cytoplasm with some aggregate formation and is notably excluded from the nucleus .

In Vitro Microtubule Severing Assays

Recombinant Spastin has been instrumental in demonstrating the protein's intrinsic microtubule-severing activity through various biochemical and microscopy-based approaches. In one key experimental paradigm, taxol-stabilized microtubules are assembled from purified tubulin and then incubated with recombinant Spastin in the presence or absence of ATP . Using videomicroscopy to monitor rhodamine-labeled microtubules immobilized in glass perfusion chambers, researchers have observed that wild-type Spastin causes breaks in microtubules over time, while ATP hydrolysis-deficient mutants do not induce severing, confirming the ATP dependence of the process .

Permeabilized Cell Assays

A sophisticated permeabilized cell assay has been developed to visualize the effects of Spastin on microtubules in a more physiologically relevant context. In this experimental approach:

  1. Cells are permeabilized with low concentrations of Triton X-100 to deplete cytosol

  2. Microtubules are stabilized with taxol to prevent spontaneous depolymerization

  3. Recombinant Spastin and ATP are added to the permeabilized cells

  4. Microtubule dynamics are monitored in real time using fluorescence microscopy

This assay has revealed that addition of wild-type Spastin and ATP to permeabilized cells results in a time-dependent decrease in microtubule content, while mutant Spastin has no effect . Once the reaction is initiated with ATP, it proceeds rapidly with all microtubules being affected to a similar degree, with breaks appearing internally along microtubules with no obvious preference for either end .

Transgenic Expression Studies

Transgenic Drosophila lines expressing either wild-type or mutant versions of Spastin have provided valuable insights into the protein's function in vivo and its role in disease pathogenesis. These studies have revealed several important findings:

Table 1: Comparison of Transgenic Expression Systems for Studying Spastin Function

Expression SystemGenotypePhenotypic OutcomeSignificance
Pan-neuronal (D WT,Ø)Wild-type Drosophila spastin in null backgroundEclosion rate increased from <6% to ~50%Demonstrates rescue capability of wild-type protein
Pan-neuronal (H WT,Ø)Wild-type human spastin in null backgroundSimilar rescue to Drosophila spastinConfirms functional conservation between species
Muscle-specificHuman spastin in wild-type backgroundDisrupted microtubule networkDemonstrates microtubule severing activity in vivo
Pan-neuronal (H L44,H R388)Human spastin with S44L and K388R mutationsExacerbated mutant phenotypesValidates trans-acting modifier effects

Disease-Relevant Mutations

Researchers have generated transgenic "AD-HSP" flies that mimic human disease genotypes by expressing specific mutant variants of Spastin. These models have provided critical insights into the molecular mechanisms underlying HSP:

  1. K388R catalytic domain mutation (corresponding to K388R in human Spastin) - This mutation affects the AAA ATPase domain and abolishes microtubule severing activity . In Drosophila, flies co-expressing wild-type human Spastin and the K388R mutant exhibit aberrant distal synapse morphology and microtubule distribution, similar to but less severe than spastin nulls .

  2. S44L and P45Q mutations - These have been identified as trans-acting modifiers of mutations affecting the Spastin catalytic domain in human pedigrees. Studies in Drosophila have confirmed that, as in humans, both L44 and Q45 variants are largely silent when heterozygous but exacerbate mutant phenotypes when expressed in trans with the R388 mutation .

Genetic Interactions

Studies have identified important genetic interactions between spastin and other genes involved in cytoskeletal regulation. A genome-wide screen for deletions that modify a spastin overexpression phenotype identified p21-activated kinase 3 (pak3) as a genetic regulator of spastin function in vivo . While pak3 mutations alone only mildly affected the neuromuscular junction (NMJ), loss of pak3 completely suppressed spastin mutant phenotypes, including microtubule distribution, synapse morphology, and synaptic function . This genetic interaction provides valuable insight into the regulatory networks controlling Spastin activity and microtubule dynamics in neurons.

Table 2: Key Spastin Mutations and Their Functional Effects

MutationDomain LocationEffect on Protein FunctionPhenotypic ConsequencesReference
K388RAAA ATPase domainLoss of ATPase and microtubule severing activityAberrant synapse morphology and microtubule distribution
E442QAAA ATPase domainATP hydrolysis deficientBinds but does not sever microtubules
S44LN-terminal regionModifier of catalytic domain mutationsExacerbates R388 phenotypes when in trans
P45QN-terminal regionModifier of catalytic domain mutationsExacerbates R388 phenotypes when in trans

ATP-Dependent Severing Process

The process of microtubule severing by recombinant Spastin has been characterized in detail through various experimental approaches. Studies using purified components have demonstrated that Spastin is sufficient for severing microtubules, without requiring additional cofactors . The severing activity is strictly dependent on ATP hydrolysis, as mutations that abolish ATPase activity (such as K388R in humans or E164A in Drosophila) completely eliminate severing function .

When wild-type recombinant Spastin is added to taxol-stabilized microtubules in the presence of ATP, it induces breaks along the length of microtubules, resulting in microtubule fragmentation . This activity is observed both with purified microtubules in vitro and in permeabilized cell assays, confirming that Spastin's severing function is intrinsic to the protein and conserved across experimental systems .

Binding and Hexamerization

Biochemical analysis has revealed that Spastin binds to microtubules even in the absence of ATP, as demonstrated by cosedimentation assays where Spastin is recovered in the pellet fraction along with microtubules . This initial binding is followed by hexamerization of Spastin monomers on the microtubule surface, forming a ring-shaped structure that is thought to exert mechanical force on the microtubule lattice during ATP hydrolysis .

The ATP hydrolysis-deficient E442Q mutant binds to microtubules but fails to sever them, indicating that binding and severing are separable activities . This mutant has been observed to bind along the lengths of immobilized microtubules without inducing breaks, further supporting the model where ATP hydrolysis drives the mechanical disruption of the microtubule lattice after initial binding has occurred .

Current Understanding

Recombinant Drosophila melanogaster Spastin has proven invaluable for elucidating the molecular mechanisms underlying microtubule severing and the pathogenesis of hereditary spastic paraplegia. The conservation of Spastin across species has enabled cross-complementation studies that validate Drosophila as a model for human disease. Key findings include:

  1. Spastin severs microtubules through an ATP-dependent mechanism involving binding, hexamerization, and ATP hydrolysis-driven mechanical disruption of the microtubule lattice .

  2. The ATPase domain is critical for severing activity, with disease-causing mutations primarily affecting this function .

  3. Genetic interactions with cytoskeletal regulators like pak3 modulate Spastin function, suggesting complex regulatory networks controlling microtubule dynamics in neurons .

  4. Human and Drosophila Spastin exhibit remarkable functional conservation, enabling the generation of genetically representative models of AD-HSP in flies .

Future Research Directions

The Drosophila model system, with its genetic tractability and conservation of Spastin function, continues to offer promising avenues for understanding the molecular basis of HSP and developing potential therapeutic approaches. Future research directions may include:

  1. Further characterization of the precise molecular mechanism by which Spastin hexamers disrupt the microtubule lattice during severing.

  2. Identification of additional genetic modifiers and interacting partners that regulate Spastin activity in vivo.

  3. Development of high-throughput screening systems using Drosophila models to identify compounds that might ameliorate HSP-related phenotypes.

  4. Investigation of tissue-specific roles and requirements for Spastin activity in different neuronal populations.

  5. Exploration of non-catalytic functions suggested by the partial rescue observed with certain catalytically inactive mutants, which might reveal additional therapeutic targets for HSP .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
spas; CG5977; Spastin; D-Spastin; Dm-Spastin; Dspastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSSTKSPIKSSSGAGSSGGGLGGRQSTHRSSSASNVAAVVAGGSSA AGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHSYGGYSSSVHKQNLYVVSF PIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPS ELNREGDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYI SKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSM ARDRLHFLALREQDLQMQRLSLKEKQKEEAQSKPQKTREPMLAGMTNEPMKLRVRSSGYG PKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPP AVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKV EWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATEC SATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASR RLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLL NRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMR AITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
Spastin is an ATP-dependent microtubule severing protein. It stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. It regulates microtubule stability in the neuromuscular junction synapse. Spastin is involved in lipid metabolism by regulating the size and distribution of lipid droplets. It also plays a role in axon regeneration by regulating microtubule severing.
Gene References Into Functions
  1. A targeting sequence directs spastin to the surface of lipid droplets. Depletion of homologous spastin proteins in both flies and worms affects lipid droplet number and triacylglycerol content. PMID: 25875445
  2. Analysis of spastin's microtubule-binding properties and comparison with katanin. PMID: 23272056
  3. Spastin is a key regulator of axon regeneration, and initiation of regeneration is extremely sensitive to the spastin copy number. PMID: 23122959
  4. Dendritic growth is regulated by Kruppel-like factor dendritic arbor reduction protein 1 (Dar1) suppressing the expression of microtubule-severing protein spastin. PMID: 21368042
  5. Spastin is essential for apical domain biogenesis during rhabdomere elongation in Drosophila photoreceptor morphogenesis. PMID: 20209135
  6. Exogenous expression of wild-type Drosophila or human spastin rescues behavioral and cellular defects in spastin null flies equivalently. PMID: 20154342
  7. The predicted gene product CG5977 has been identified as the Drosophila homolog of the human spastin gene, with much higher sequence similarities than any other related AAA domain protein in the fly. PMID: 12908108
  8. D-spastin displays ATPase activity and utilizes energy from ATP hydrolysis to sever and disassemble microtubules; disease mutations abolish or partially interfere with these activities. PMID: 15823537
  9. X-ray structure data supports a model in which spastin pulls the C terminus of tubulin through its central pore, generating a mechanical force that destabilizes tubulin-tubulin interactions within the microtubule lattice. PMID: 18202664

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG5977

STRING: 7227.FBpp0083918

UniGene: Dm.7035

Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.