Recombinant Drosophila melanogaster Sphingomyelin synthase-related 1 (SMSr)

Shipped with Ice Packs
In Stock

Description

Post-translational Modifications

According to the iPTMnet database, Drosophila melanogaster SMSr undergoes phosphorylation at multiple sites, which may regulate its activity or interactions . Key phosphorylation sites include:

SiteModification TypeSource
T514Phosphorylationphospho.ELM UniProt
S525Phosphorylationphospho.ELM UniProt
T548Phosphorylationphospho.ELM UniProt

These post-translational modifications may play crucial roles in regulating SMSr function, though their specific effects require further investigation.

Recombinant Production and Properties

The recombinant form of Drosophila melanogaster SMSr is typically produced in E. coli expression systems with an N-terminal His-tag to facilitate purification . Commercial preparations offer the following specifications:

Physical and Biochemical Properties

PropertySpecification
FormLyophilized powder
PurityGreater than 90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Reconstitution0.1-1.0 mg/mL in deionized sterile water
Long-term Storage-20°C/-80°C with 5-50% glycerol

For optimal stability, repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

Ceramide Phosphoethanolamine Synthase Activity

The primary enzymatic function of SMSr is the synthesis of ceramide phosphoethanolamine (CPE), an analog of sphingomyelin that is prevalent in invertebrates . This reaction involves the transfer of phosphoethanolamine from phosphatidylethanolamine (PE) to ceramide:

Ceramide + Phosphatidylethanolamine → Ceramide Phosphoethanolamine + Diacylglycerol

Alternative Enzymatic Activities

Recent research has revealed that SMSr may also function as a phosphatidylethanolamine-phospholipase C (PE-PLC), capable of hydrolyzing PE to generate diacylglycerol in the absence of ceramide . This activity appears to be specific to PE, as SMSr shows no phospholipase activity toward other phospholipids such as phosphatidylcholine, phosphatidylserine, or phosphatidylglycerol .

The dual enzymatic capabilities of SMSr are summarized in the following table:

Enzymatic ActivitySubstratesProductsRelative Activity
CPE SynthaseCeramide + PECPE + DAGVery low (trace amounts)
PE-PLCPEDAG + PhosphoethanolamineSignificant in vivo

Experiments in mouse liver demonstrated that overexpression of SMSr significantly reduced PE levels while increasing DAG, supporting its function as a PE-PLC in vivo .

Endoplasmic Reticulum Localization

Unlike SMS1 (Golgi) and SMS2 (plasma membrane), SMSr is predominantly localized to the endoplasmic reticulum, where ceramides are synthesized de novo . This strategic positioning allows SMSr to monitor and regulate ceramide levels at their primary site of production.

SAM Domain-Mediated Oligomerization

A key feature of SMSr is its ability to form oligomeric structures through its N-terminal SAM domain . Native gel electrophoresis and chemical crosslinking studies have demonstrated that SMSr self-associates into ER-resident trimers and hexamers that resemble helical oligomers formed by other SAM domain-containing proteins .

The oligomerization of SMSr appears to be functionally significant:

  1. Residues critical for oligomerization are evolutionarily conserved

  2. Mutations that disrupt oligomerization cause partial redistribution of SMSr from the ER to the Golgi

  3. Treatments that disrupt ceramide homeostasis in the ER stabilize SMSr oligomers and enhance ER retention

These findings provide evidence that SAM-mediated self-assembly is required for efficient retention of SMSr in the ER, which is crucial for its function in ceramide regulation .

Ceramide Sensor Function

The most significant finding regarding SMSr function is its role as a ceramide sensor and regulator. Despite producing only trace amounts of CPE, blocking SMSr activity causes a substantial rise in ER ceramide levels and a structural collapse of the early secretory pathway .

In SMSr-depleted HeLa cells, ceramide levels increased approximately three-fold, with a concomitant rise in glucosylceramide (GlcCer) levels . This accumulation was 50-fold higher than could be attributed to a block in CPE production, indicating that SMSr's primary function is negative regulation of ceramide levels rather than bulk CPE synthesis .

Anti-Apoptotic Activity

SMSr serves as a suppressor of ceramide-mediated apoptosis in cells . This anti-apoptotic activity requires both:

  1. A catalytically active enzyme

  2. The protein's N-terminal SAM domain

Interestingly, SMSr itself can become a target of the apoptotic machinery during cell death. Treatment of cells with apoptosis inducers triggers caspase-6-mediated cleavage of SMSr at a conserved aspartate located between the enzyme's SAM domain and its first membrane span .

Comparison with Drosophila Sphingolipid Metabolism

Unlike mammals, Drosophila melanogaster does not synthesize sphingomyelin but produces CPE as a major membrane constituent . While SMSr produces only trace amounts of CPE, bulk production in Drosophila is mediated by a different enzyme system .

In Drosophila S2 cells, depletion of SMSr reduced cell lysate-associated CPE synthase activity by 60-70%, yet had no significant impact on CPE production in intact cells . This suggests the existence of an alternative CPE production pathway, possibly involving an enzyme that uses CDP-ethanolamine rather than phosphatidylethanolamine as a head group donor .

Evolutionary Conservation and Significance

SMSr is the most conserved member of the multigenic sphingomyelin synthase family, found across species from insects to mammals . This high degree of conservation, despite differences in sphingolipid compositions between species, underscores SMSr's fundamental importance in cellular homeostasis.

In Drosophila, small open reading frame (smORF) analyses have identified SMSr among 298 evolutionarily conserved smORFs between Drosophila melanogaster and humans . This conservation extends through the bilaterian lineage, with many smORFs even conserved in plants, indicating their essential functions .

Tools for Sphingolipid Research

Recombinant Drosophila melanogaster SMSr serves as a valuable tool for studying sphingolipid metabolism and ceramide homeostasis. Commercial antibodies against Drosophila SMSr, such as rabbit polyclonal antibodies, are available for Western blotting applications , facilitating studies of expression, localization, and function.

Potential Therapeutic Implications

Understanding SMSr function has significant implications for human health, particularly regarding ceramide-related pathologies. The enzyme's role in controlling ceramide levels and suppressing ceramide-mediated apoptosis suggests potential relevance to:

  1. Cancer biology

  2. Neurodegenerative disorders

  3. Metabolic diseases

Given SMSr's prominent expression in the brain and its cleavage by caspase-6 (implicated in Huntington's and Alzheimer's diseases), future research may uncover connections between SMSr dysfunction and neurodegenerative conditions .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any preferred format requirements in your order notes, and we will do our best to accommodate them.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
SMSr; CG32380; Ceramide phosphoethanolamine synthase; CPE synthase; Sphingomyelin synthase-related 1; SMSr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
SMSr
Target Protein Sequence
MCDGEIGDPVTQPRSEGGGLVTMDQETRTHYLDAATDKHLTNGSPDPEPVDPLLVAQWSI ENVTSWATCMEHFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYKLGYKLTFGELKKFWI AVLKLQLLVKNSSAESVILGIECHGNGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSD CDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDN VPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLS VPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTV ALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYY HTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYDTLGSLIDGIIEQIFKAKDQL AISVKRCWLDAPLSGNSSAHMFGGESEQCLRNGTASAAFFSPHQSLIGGLGGQRSQTHLN SAQSGSSTPTPATSAPTKSLPTQKKTFRDASVDPFSRTTFAAVQQAENVKDSPMKEKKHL
Uniprot No.

Target Background

Function
Sphingomyelin synthase-related 1 (SMSr) is a phosphatidylethanolamine (PE)/ceramide ethanolamine phosphotransferase in Drosophila melanogaster. It catalyzes the synthesis of ceramide phosphoethanolamines (CPE), a class of lipids that are analogous to sphingomyelin and are a major membrane component in Drosophila. SMSr transfers the head group from PE (1,2-diacyl-sn-glycero-3-phosphoethanolamine) to various ceramides, including N-acylsphinganine (dihydroceramide) and N-acyl-(4R)-hydroxysphinganine (phytoceramide), producing N-acyl-sphinganine-1-phosphoethanolamine and N-acyl-(4R)-hydroxysphinganine-1-phosphoethanolamine, respectively. Acting as a ceramide sensor, SMSr plays a crucial role in regulating ceramide homeostasis within the endoplasmic reticulum, which is essential for the integrity of the early secretory pathway.
Database Links

KEGG: dme:Dmel_CG32380

STRING: 7227.FBpp0076580

UniGene: Dm.874

Protein Families
Sphingomyelin synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Why is Drosophila melanogaster suitable for studying conserved protein functions like SMSr?

Drosophila melanogaster offers several key advantages for studying proteins like SMSr. The fruit fly has homologues to approximately 80% of all human disease-associated genes, making it highly relevant for translational research . Its short life cycle (approximately 10 days at 25°C) enables rapid experimental timelines, while its complete life cycle of around 90 days allows observation throughout development . Importantly, tissue-specific controlled overexpression or knockdown of genes is considerably easier in Drosophila compared to mammalian models, facilitating targeted SMSr studies . The availability of fluorochrome-labeled reporter lines further enhances visualization of modified genes in specific tissues .

What are the key developmental stages of Drosophila melanogaster relevant to SMSr expression studies?

Drosophila melanogaster development includes four distinct stages that researchers should consider when designing SMSr expression studies:

  • Egg (embryo) stage: Typically lasts one day and represents early developmental processes

  • Larval stage: Progresses through L1, L2, and L3 phases over approximately 5 days at 25°C

  • Pupal stage: Involves complete metamorphosis over about 4 days, with significant tissue remodeling

  • Adult stage: Post-eclosion mature fly

Each developmental stage offers unique opportunities for studying SMSr expression and function, particularly as the protein may have stage-specific roles in membrane homeostasis and ceramide regulation.

How should researchers design tissue-specific SMSr expression studies in Drosophila melanogaster?

For effective tissue-specific SMSr expression studies, researchers should implement the following methodological approach:

  • Selection of appropriate driver lines: Choose GAL4 driver lines that express in tissues of interest for SMSr function (e.g., neural tissues, fat body, or airway epithelium).

  • Construction of UAS-SMSr constructs: Develop both wild-type and mutant versions of SMSr to assess functional domains.

  • Reporter integration: Include fluorescent reporters (e.g., GFP-tagged SMSr) to visualize expression patterns in vivo.

  • Temporal control: Consider using temperature-sensitive GAL80 inhibitors for temporal control of expression if developmental timing is critical.

  • Validation strategy: Confirm SMSr expression levels using RT-qPCR and Western blotting techniques similar to those used for gene expression studies in Drosophila .

The Drosophila system enables precise genetic manipulation with a large toolbox for tissue-specific gene modification, making it particularly suitable for studying SMSr's role in specific cellular contexts .

What controls are essential when characterizing SMSr mutant phenotypes in Drosophila?

When characterizing SMSr mutant phenotypes, the following controls are essential:

  • Genetic background controls: Use isogenic lines to minimize background genetic variation.

  • Rescue experiments: Perform genetic rescue with wild-type SMSr to confirm phenotype specificity.

  • Multiple alleles or constructs: Test multiple independent mutant alleles or RNAi constructs to rule out off-target effects.

  • Driver-only and UAS-only controls: Include GAL4 driver-only and UAS-construct-only controls to account for insertion effects.

  • Dosage controls: Test different expression levels to distinguish between loss-of-function and neomorphic effects.

  • Tissue specificity validation: Confirm the expression pattern of your GAL4 driver in tissues where SMSr function is being studied.

These controls help establish causality between SMSr perturbation and observed phenotypes, a critical consideration in Drosophila genetics where the short lifespan facilitates transgenerational studies .

What are the optimal methods for purifying recombinant Drosophila melanogaster SMSr for in vitro studies?

The purification of recombinant Drosophila melanogaster SMSr requires specialized protocols due to its membrane-associated nature:

  • Expression system selection: While bacterial expression systems like E. coli are cost-effective, eukaryotic systems (insect cells or yeast) better maintain post-translational modifications and proper folding of Drosophila proteins.

  • Construct design considerations:

    • Include a cleavable affinity tag (His6, FLAG, or GST)

    • Consider truncating transmembrane domains for improved solubility

    • Optimize codon usage for the selected expression system

  • Membrane protein extraction protocol:

    • Use gentle detergents (DDM, CHAPS, or digitonin)

    • Implement two-phase partitioning for membrane fraction enrichment

    • Consider nanodiscs or liposomes for maintaining native conformation

  • Quality control metrics:

    • Size-exclusion chromatography to confirm monodispersity

    • Circular dichroism to verify secondary structure integrity

    • Activity assays to confirm functional preservation

Similar approaches for protein isolation and characterization have been successfully employed for examining RecA-like recombinases in other model organisms .

How can researchers accurately measure SMSr enzymatic activity in Drosophila tissue samples?

To accurately measure SMSr enzymatic activity in Drosophila tissue samples, researchers should follow this methodological framework:

  • Tissue preparation:

    • Collect specific tissues (brain, fat body, or whole larvae) based on experimental needs

    • Homogenize in buffer containing protease inhibitors and appropriate detergents

    • Separate membrane fractions using ultracentrifugation

  • Activity assay setup:

    • Incubate membrane fractions with fluorescent or radiolabeled ceramide substrates

    • Optimize reaction conditions (pH, temperature, cofactors)

    • Include selective inhibitors to distinguish SMSr activity from other lipid-modifying enzymes

  • Product analysis:

    • Utilize thin-layer chromatography (TLC) for basic separation

    • Implement LC-MS/MS for comprehensive lipid profiling

    • Consider using deuterated internal standards for absolute quantification

  • Data normalization strategies:

    • Normalize to protein content

    • Use housekeeping enzyme activities as internal references

    • Compare to genetically matched controls

  • Validation approaches:

    • Confirm specificity using SMSr knockdown/knockout samples

    • Perform substrate competition assays

    • Characterize kinetic parameters (Km, Vmax)

This comprehensive approach allows researchers to precisely characterize SMSr activity across different developmental stages and experimental conditions.

What CRISPR/Cas9 strategies are most effective for generating SMSr mutants in Drosophila melanogaster?

For generating precise SMSr mutants in Drosophila melanogaster using CRISPR/Cas9, researchers should consider the following methodological approach:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Design multiple gRNAs targeting different exons

    • Prioritize conserved functional domains for knockout strategies

  • Repair template considerations:

    • For precise mutations, design homology-directed repair (HDR) templates

    • Include visible markers (e.g., white+ or DsRed) for easier screening

    • Consider scarless techniques for sensitive functional studies

  • Delivery method optimization:

    • Inject components into embryos at the posterior pole

    • Use appropriate promoters (e.g., nos-Cas9 for germline expression)

    • Consider optimizing Cas9 expression timing for higher efficiency

  • Screening strategy:

    • Implement molecular screening (T7 endonuclease, HRMA, or direct sequencing)

    • Design PCR primers for distinguishing mutant and wild-type alleles

    • Validate mutations at both DNA and protein levels

  • Off-target analysis:

    • Sequence potential off-target sites predicted by bioinformatic tools

    • Backcross lines to remove potential off-target mutations

    • Perform genetic rescue experiments to confirm phenotype specificity

This approach leverages Drosophila's genetic tractability, which allows for tissue-specific gene modification that can help identify novel targets involved in various biological processes .

How should researchers interpret contradictory phenotypes from different SMSr knockdown approaches?

When confronted with contradictory phenotypes from different SMSr knockdown approaches, researchers should implement this analytical framework:

  • Systematic comparison of methodologies:

    Knockdown MethodAdvantagesLimitationsPotential Artifacts
    RNAiTissue-specific, tunableOff-target effects, incomplete KDPassenger mutations, position effects
    CRISPR/Cas9 KOComplete protein lossGlobal effects, potential compensationOff-target mutations, developmental adaptation
    Dominant negativeAcute inhibitionNon-physiological protein levelsInterference with related proteins
    Chemical inhibitionRapid and reversiblePotential off-target effectsNon-specific chemical interactions
  • Knockdown/knockout validation protocol:

    • Quantify SMSr mRNA levels via RT-qPCR

    • Assess protein depletion through Western blot or immunostaining

    • Measure enzymatic activity using biochemical assays

  • Resolution strategies:

    • Use multiple independent RNAi lines or CRISPR-generated alleles

    • Perform genetic rescue experiments with wild-type SMSr

    • Combine approaches (e.g., chemical inhibition in genetic backgrounds)

    • Analyze tissue-specific versus global knockdown effects

  • Context-dependent factors to consider:

    • Developmental timing of knockdown

    • Genetic background variations

    • Environmental conditions

    • Maternal contribution effects

This analytical approach recognizes that contradictory results often reveal context-dependent functions or technical limitations rather than experimental failures. Similar analytical frameworks have been used in resolving contradictory findings in recombination studies in other model organisms .

How can researchers effectively analyze SMSr's role in lipid homeostasis across different Drosophila tissues?

To comprehensively analyze SMSr's role in lipid homeostasis across different Drosophila tissues, researchers should implement this multi-tiered approach:

  • Tissue-specific lipid profiling:

    • Dissect specific tissues (brain, fat body, intestine, airway epithelium)

    • Extract lipids using modified Bligh-Dyer or MTBE methods

    • Perform targeted lipidomics via LC-MS/MS focusing on ceramides, sphingomyelins, and ceramide phosphoethanolamines

  • Subcellular localization analysis:

    • Generate fluorescently tagged SMSr constructs

    • Co-localize with organelle markers (ER, Golgi, plasma membrane)

    • Implement super-resolution microscopy for detailed localization

  • Functional assays for lipid homeostasis:

    • Measure membrane fluidity using fluorescence anisotropy

    • Assess ER stress markers (BiP, PERK phosphorylation)

    • Analyze autophagy markers in response to SMSr perturbation

  • Integrate with physiological parameters:

    • Measure metabolic rates using techniques established for Drosophila

    • Assess lipid storage through Nile Red or Oil Red O staining

    • Analyze lifespan and stress resistance phenotypes

  • Genetic interaction studies:

    • Test interactions with other lipid metabolism genes

    • Perform dietary lipid supplementation experiments

    • Create double mutants with known ceramide metabolism regulators

This comprehensive approach leverages Drosophila's well-defined developmental stages and tissue systems, which have proven valuable in other research contexts including airway epithelium studies .

What advanced imaging techniques are most informative for studying SMSr localization and function in Drosophila tissues?

For advanced imaging of SMSr localization and function in Drosophila tissues, researchers should consider these methodological approaches:

  • Super-resolution microscopy applications:

    • STED microscopy: Achieves 30-70 nm resolution for precise organelle localization

    • PALM/STORM: Enables single-molecule localization to detect SMSr clustering

    • SIM: Provides 100-120 nm resolution with less phototoxicity for live imaging

  • Live imaging strategies:

    • Photoactivatable/photoconvertible SMSr fusions to track protein dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Optogenetic tools to manipulate SMSr activity with spatiotemporal precision

  • Multiplex imaging approaches:

    • Multi-color imaging with orthogonal fluorescent proteins

    • Combinatorial antibody labeling for simultaneous detection of multiple proteins

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

  • Functional imaging techniques:

    • FRET-based sensors for detecting SMSr enzymatic activity

    • Lipid-binding probes to visualize ceramide distribution

    • Calcium indicators to correlate SMSr activity with ER calcium homeostasis

  • Sample preparation considerations:

    • Optimization of fixation protocols to preserve membrane structures

    • Clearing techniques for deep tissue imaging

    • Appropriate mounting media to reduce photobleaching

These advanced imaging approaches can be complemented by 3D transmission electron microscopy techniques similar to those used for structural analysis in other Drosophila studies .

How can insights from Drosophila SMSr studies be effectively translated to mammalian systems?

To translate findings from Drosophila SMSr studies to mammalian systems, researchers should implement the following methodological framework:

  • Comparative sequence and structural analysis:

    • Perform phylogenetic analysis of SMSr across species

    • Identify conserved functional domains and critical residues

    • Model protein structures to predict functional consequences of mutations

  • Functional conservation testing strategy:

    • Express mammalian SMSr orthologs in Drosophila SMSr mutants to test rescue

    • Create equivalent mutations in both systems to compare phenotypes

    • Analyze substrate specificity using in vitro enzymatic assays

  • Pathway conservation assessment:

    • Compare interacting partners through proteomics approaches

    • Analyze stress response pathways in both systems

    • Examine downstream transcriptional responses

  • Disease model development:

    • Generate Drosophila models expressing human disease-associated SMSr variants

    • Validate phenotypes in mammalian cell culture and mouse models

    • Develop high-throughput screens in Drosophila for therapeutic discovery

  • Experimental design considerations:

    • Account for differences in lipid composition between systems

    • Consider tissue-specific functions that may not be conserved

    • Adjust for differences in developmental timing

This translational approach leverages Drosophila's validated utility as a model organism that shares approximately 80% of human disease-associated genes , making it particularly valuable for preliminary studies before moving to more complex mammalian systems.

What considerations should researchers take into account when designing SMSr inhibitor screens using Drosophila?

When designing SMSr inhibitor screens using Drosophila, researchers should consider these methodological considerations:

  • Screening platform optimization:

    • Whole organism versus cell-based primary screens

    • Phenotypic readouts (development, lifespan, stress resistance)

    • Reporter systems (fluorescent lipid sensors, stress response elements)

  • Compound library selection criteria:

    • Focus on lipid-mimetic structures

    • Include FDA-approved drugs for repurposing potential

    • Consider natural product libraries with membrane-active compounds

  • Delivery method considerations:

    • Food incorporation for oral administration

    • Microinjection for precise dosing

    • Topical application for cuticle penetration assessment

  • Validation cascade:

    Validation StepMethodologyPurpose
    Target engagementThermal shift assays, competitive bindingConfirm direct SMSr interaction
    Enzymatic inhibitionIn vitro activity assays with purified proteinEstablish potency and mechanism
    Lipid profilingLC-MS/MS lipidomicsConfirm expected changes in lipid composition
    Specificity testingTesting against related enzymesDetermine selectivity profile
    Genetic validationTesting in SMSr mutantsConfirm on-target effects
  • Pharmacokinetic considerations:

    • Assess compound stability in fly food

    • Measure tissue distribution using LC-MS/MS

    • Evaluate metabolism through extraction and analysis

This comprehensive screening approach takes advantage of Drosophila's experimental tractability, including its well-defined airway epithelium and microbiome, which parallel aspects of human systems , while providing a pathway to identify compounds with translational potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.