Recombinant Drosophila melanogaster Sugar transporter SWEET1 (slv)

Shipped with Ice Packs
In Stock

Description

Functional Role

SWEET1 (slv) functions as a low-affinity transporter facilitating both uptake and efflux of sugars in Drosophila melanogaster . Key mechanistic insights include:

  • Bidirectional Transport: Mediates sugar movement across membranes without requiring ATP, acting as a facilitative uniporter .

  • Physiological Relevance: Likely supports energy distribution in fly tissues, analogous to plant SWEETs involved in phloem loading and pathogen responses .

  • Contrast with Human SWEET1: The human homolog (SLC50A1) is implicated in glucose transport and immune cell recombination (V(D)J) but shares limited functional overlap with insect SWEET1 .

Research Applications

Recombinant SWEET1 (slv) is critical for:

  • Sugar Transport Studies: Used to dissect kinetics and regulation of sugar flux in insect models .

  • Pathogen Interaction Models: Plant SWEETs are exploited by pathogens for nutrient acquisition; Drosophila SWEET1 may offer insights into analogous host-pathogen dynamics .

  • Comparative Genomics: Highlights evolutionary divergence, as Drosophila retains a single SWEET gene, while plants have ~20 paralogs .

Future Directions

Current research gaps include:

  • Structural Insights: No resolved 3D structure for Drosophila SWEET1, limiting mechanistic studies .

  • In Vivo Functional Analysis: Role in fly metabolism, aging, or behavior remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
slv; CG8717; Sugar transporter SWEET1; Protein saliva
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
slv
Target Protein Sequence
MSAVAYDSLLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYG VLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQFGFVLTVLVVVIVYTNRLEDQ RDRMIHVTGIVCCIVTVCFFAAPLASLLHVIRAKNSESLPLPLIATSFVVSLQWLIYGIL ISDSFIQIPNFLGCILSLLQLGLFVLYPPRSYSGHGYKLVEQAVPF
Uniprot No.

Target Background

Function
Facilitates both low-affinity uptake and efflux of sugar across the membrane.
Database Links

KEGG: dme:Dmel_CG8717

STRING: 7227.FBpp0302050

UniGene: Dm.3252

Protein Families
SWEET sugar transporter family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing functional recombinant Drosophila SWEET1?

For successful expression of recombinant Drosophila SWEET1, researchers should consider both prokaryotic and eukaryotic expression systems, each with distinct advantages:

  • Yeast expression systems: The search results indicate successful expression of plant SWEET transporters in yeast strains, particularly those lacking endogenous hexose transporters (e.g., EBY4000) . For Drosophila SWEET1, a similar approach can be employed using:

    • The constitutive GPD promoter for strong expression

    • Genomic integration for stable expression

    • Multicopy plasmids when higher protein levels are required

  • Insect cell lines: Drosophila S2 cells or Sf9 cells (from Spodoptera frugiperda) provide a more native environment for proper folding and post-translational modifications of insect membrane proteins.

  • Mammalian cell lines: HEK293 or CHO cells can be used when studying potential interactions with mammalian proteins or for applications requiring mammalian glycosylation patterns.

The optimal expression method depends on the experimental goals. For structural studies requiring large protein quantities, yeast or bacterial systems may be preferable. For functional studies requiring proper folding and post-translational modifications, insect cell lines are often optimal.

What methods can accurately measure transport activity of Drosophila SWEET1?

Several complementary approaches can be used to assess the transport activity of recombinant Drosophila SWEET1:

  • Radiolabeled sugar uptake assays: This gold standard approach measures the cellular uptake of radiolabeled substrates (e.g., 14C-glucose, 3H-fructose) mediated by the transporter. The search results indicate this method has been successfully used for plant SWEET transporters and could be adapted for Drosophila SWEET1 .

  • Fluorescent biosensor-based assays: Building on the success of SweetTrac1 and SweetTrac2 for plant SWEETs , researchers could develop a "DrosophilaSweetTrac" by:

    • Creating an intramolecular fusion of a conformation-sensitive fluorescent protein within SWEET1

    • Measuring fluorescence changes upon substrate binding

    • Using this approach to screen potential substrates

  • Electrophysiological methods: Whole-cell patch-clamp or two-electrode voltage clamp techniques in Xenopus oocytes can directly measure transport-associated currents.

  • Growth complementation assays: Expression of SWEET1 in yeast strains lacking endogenous sugar transporters (e.g., EBY4000) followed by growth assessment on various sugar substrates can identify transported sugars .

The most robust experimental design would combine multiple approaches, using radiolabeled uptake to confirm findings from fluorescence-based screening methods.

What is known about the substrate specificity of Drosophila SWEET1?

While the search results don't provide direct experimental data on Drosophila SWEET1 substrate specificity, insights can be drawn from studies on plant SWEET transporters and predicted based on structural analysis.

From research on Arabidopsis SWEET1 and SWEET2, we know that these transporters recognize similar substrates but with different affinities . The substrate binding pocket of SWEETs contains both specific interaction sites (through hydrogen bonding) and nonspecific interactions mediated by hydrophobic residues that determine the size and shape of the binding pocket .

By sequence alignment and structural comparison with characterized plant SWEETs, researchers could identify conserved residues in Drosophila SWEET1 that might be involved in:

  • Specific hydrogen bonding (similar to N73 and N192 in AtSWEET1)

  • Hydrophobic interactions (similar to V69, I72, and V188 in AtSWEET1)

Based on plant SWEET studies, potential substrates for testing with Drosophila SWEET1 would include:

  • Hexoses: D-glucose, D-fructose, D-mannose

  • Modified sugars: 1-deoxynojirimycin, voglibose, 1-thio-D-glucose

  • Other sugar analogs that fit the binding pocket dimensions

How do specific amino acid residues contribute to substrate binding in SWEET1?

Research on plant SWEETs provides a framework for understanding how amino acid residues contribute to substrate binding in Drosophila SWEET1. The search results indicate two types of critical interactions in SWEET transporters :

  • Specific interactions: Key conserved residues form hydrogen bonds with hydroxyl groups on sugar substrates. In Arabidopsis SWEET1, these include:

    • N73 and N192, which when mutated abolished transport function

    • Similar conserved residues likely exist in Drosophila SWEET1

  • Nonspecific interactions: Hydrophobic residues determine the binding pocket's size and shape. In Arabidopsis SWEET1, these include:

    • V69, I72, and V188, which affect substrate affinity

    • Mutagenesis studies showed that:

      • Making the binding pocket smaller (V188I, V188L) increased affinity for D-glucose, D-mannose, and D-fructose

      • Making the binding pocket larger (V188A) decreased affinity

To investigate these interactions in Drosophila SWEET1, researchers should:

  • Perform sequence alignment with characterized SWEETs

  • Identify conserved residues in the putative binding pocket

  • Conduct site-directed mutagenesis of these residues

  • Measure changes in transport activity and substrate affinity

This approach would reveal the molecular basis of substrate recognition and could guide protein engineering efforts to modify substrate specificity.

How does the AlphaFold-predicted structure of Drosophila SWEET1 compare to experimental structures of other SWEET transporters?

The AlphaFold-predicted structure of Drosophila SWEET1 (AF_AFQ7JVE7F1) has a high global confidence score (pLDDT: 92.12), suggesting it is likely an accurate representation of the protein's native structure . To evaluate this model:

The AlphaFold model provides a valuable starting point for structure-based studies, but experimental validation through techniques such as site-directed mutagenesis remains essential to confirm structural predictions.

What structural features distinguish SWEET1 from other sugar transporters in Drosophila?

While the search results don't provide comprehensive information about other Drosophila sugar transporters, general structural comparisons can be made between SWEET transporters and other sugar transporter families:

  • SWEET transporters (including Drosophila SWEET1):

    • Typically smaller proteins (~200-300 amino acids)

    • Function as uniporters

    • Share a characteristic 3+1+3 transmembrane domain arrangement

    • Operate through an alternating access mechanism

  • Other sugar transporter families in Drosophila may include:

    • GLUT family transporters (facilitative glucose transporters)

    • SGLT family transporters (sodium/glucose cotransporters)

    • Trehalose transporters (important for insect hemolymph sugar transport)

The primary structural differences likely include:

  • Number and arrangement of transmembrane domains

  • Nature of the substrate binding pocket

  • Presence of additional functional domains

  • Coupling to ion gradients (in some transporters)

Understanding these structural distinctions is essential for predicting functional differences and designing selective inhibitors or modulators of specific transporter types.

How can Drosophila SWEET1 contribute to our understanding of human disease mechanisms?

Drosophila melanogaster is a well-established model organism for studying human diseases, including those related to metabolism and transport . SWEET1 research can contribute to human disease understanding in several ways:

  • Diabetes and glucose homeostasis: As a sugar transporter, SWEET1 function in Drosophila can provide insights into fundamental mechanisms of sugar transport and metabolism relevant to diabetes research. Drosophila has been used to generate models of human disease using data from The Cancer Genome Atlas, suggesting similar approaches could be applied to metabolic disorders .

  • Cancer metabolism: Cancer cells often display altered glucose metabolism (Warburg effect). The search results indicate Drosophila has been used as a model for various cancers, including colorectal cancer . Understanding SWEET1's role in sugar transport could illuminate aspects of cancer cell metabolism.

  • Signaling pathway interactions: SWEET1 may interact with conserved signaling pathways implicated in human diseases. For example, the search results mention the MAPK, PI3K/AKT/mTOR, and JAK/STAT pathways, which are relevant to both Drosophila models and human diseases .

  • Genetic screens: Drosophila SWEET1 can be used in genetic screens to identify modifiers of sugar transport function, potentially revealing novel genes relevant to human metabolic disorders.

The high conservation of many fundamental biological processes between Drosophila and humans makes SWEET1 research potentially valuable for understanding human disease mechanisms, particularly those related to sugar metabolism and transport.

How does Drosophila SWEET1 compare to plant and bacterial SWEET transporters?

Comparative analysis of SWEET transporters across different kingdoms provides insights into their evolution and specialized functions:

  • Sequence and structural comparison:

    • Plant genomes typically contain ~20 SWEET homologs

    • Bacterial genomes contain SemiSWEETs, which are smaller versions with fewer transmembrane domains

    • Drosophila SWEET1's 226-amino acid sequence suggests it's more similar in size to plant SWEETs than to bacterial SemiSWEETs

  • Substrate specificity:

    • Plant SWEETs like Arabidopsis SWEET1 and SWEET2 transport various sugars including D-glucose, D-fructose, and D-mannose

    • The binding pocket architecture determines substrate specificity, with specific residues forming hydrogen bonds with sugar hydroxyl groups and hydrophobic residues determining pocket size and shape

    • Comparative analysis of binding pocket residues between Drosophila SWEET1 and plant SWEETs could predict substrate preferences

  • Functional evolution:

    • Plant SWEETs are central for sugar allocation in plants

    • Bacterial SemiSWEETs serve as evolutionary building blocks for eukaryotic SWEETs

    • Drosophila SWEET1's name ("slv" - saliva ) suggests potential specialization for functions in the salivary gland

The comparative analysis of SWEET transporters across species provides a powerful approach for understanding their evolutionary history and predicting functional properties based on conserved structural features.

How can biosensors be developed to study Drosophila SWEET1 activity in real-time?

Building on the success of plant SWEET biosensors (SweetTrac1 and SweetTrac2), researchers could develop similar tools for Drosophila SWEET1 . A methodological approach would include:

  • Design strategy:

    • Identify conformationally sensitive regions in Drosophila SWEET1 using the AlphaFold structural model

    • Insert a fluorescent protein (e.g., cpGFP) at a site that undergoes conformational changes during transport

    • Create fusion constructs with different linker lengths and compositions

    • Screen for constructs that show fluorescence changes upon substrate binding

  • Validation approach:

    • Express candidate biosensors in appropriate cell lines

    • Test fluorescence response to known SWEET substrates (glucose, fructose, mannose)

    • Validate with non-fluorescent methods (e.g., radiolabeled uptake)

    • Characterize kinetic parameters (Kd, response time)

  • Applications of a "DrosophilaSweetTrac" biosensor:

    • High-throughput screening for novel substrates or inhibitors

    • Real-time imaging of sugar transport in live Drosophila tissues

    • Monitoring transport activity under different physiological conditions

    • Studying the effects of mutations on transport function

The plant SweetTrac biosensors have demonstrated the feasibility of this approach, with SweetTrac2 successfully monitoring sugar transport at vacuolar membranes that would otherwise be challenging to study .

What are the most promising approaches for studying SWEET1's role in Drosophila development and physiology?

To elucidate SWEET1's physiological roles in Drosophila, researchers should employ multifaceted approaches:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated knockout or knockdown of the slv gene

    • Tissue-specific RNAi to assess function in specific organs

    • Generation of point mutations in key residues to alter transport without eliminating protein expression

    • Overexpression studies to assess gain-of-function phenotypes

  • Physiological and metabolic analysis:

    • Measurement of hemolymph and tissue sugar levels in SWEET1 mutants

    • Glucose tolerance tests to assess whole-organism sugar metabolism

    • Feeding behavior assays to determine effects on nutrient intake

    • Lifespan and stress resistance studies to identify broader physiological impacts

  • Developmental biology approaches:

    • Analysis of SWEET1 expression patterns throughout development using in situ hybridization or reporter constructs

    • Assessment of developmental phenotypes in SWEET1 mutants

    • Examination of potential roles in specific developmental processes (e.g., salivary gland development, given the "slv" gene name )

  • Integration with other model systems:

    • Comparison with mammalian sugar transporter function

    • Assessment of conservation with plant SWEET transporter physiological roles

    • Translation of findings to human metabolic research

Drosophila's powerful genetic tools, combined with its well-characterized development and physiology, make it an ideal system for comprehensive functional analysis of SWEET1's biological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.