Recombinant Drosophila melanogaster SURF1-like protein (Surf1)

Shipped with Ice Packs
In Stock

Description

Production and Purity Metrics

Recombinant Surf1 is synthesized using heterologous expression systems. Key parameters include:

ParameterDetailsSource
Host SystemE. coli (prokaryotic) , Baculovirus (eukaryotic)
TagN-terminal His-tag (1–300 aa full-length) ; no tag specified for partial
Purity>90% (SDS-PAGE) ; ≥85% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

Biochemical Studies

The recombinant protein is used to:

  • Analyze COX assembly defects: Surf1 knockdown in Drosophila S2R+ cells reduces COX activity and oxygen consumption .

  • Validate antibody specificity: In Western blot and immunoprecipitation assays .

Disease Modeling

In Drosophila, Surf1 knockdown replicates LS phenotypes:

Knockdown ContextPhenotypeSource
Ubiquitous (Actin5C-GAL4)Larval/adult lethality; pan-respiratory complex defects (CI–CV)
CNS-specific (elav-GAL4)Survival with COX-selective impairment in adults
Mesodermal (how24B-GAL4)Pupal lethality; muscle-specific COX deficiency

Comparative Analysis of Recombinant SURF1 Proteins

Recombinant Surf1 from Drosophila is distinct from homologs in other species:

SpeciesHost SystemTagPurityApplicationsSource
D. melanogasterE. coliHis-tag>90%SDS-PAGE, Western blot
Arabidopsis thalianaCell-freeNone≥85%Biochemical assays
Xenopus tropicalisCell-freeNone≥85%Functional studies
Mus musculusCell-freeNone≥85%Comparative modeling

Key Research Findings

  1. COX Dependency: Surf1 is indispensable for COX activity in Drosophila; its absence disrupts COX assembly, particularly in adults .

  2. Developmental Sensitivity:

    • Larvae: Global respiratory complex defects (CI–CV) .

    • Adults: Selective COX impairment with preserved CI–III and V activities .

  3. Therapeutic Implications: The Drosophila model aids in studying COX biogenesis and testing interventions for LS .

Handling and Stability

ParameterRecommendationSource
Storage-20°C/-80°C (lyophilized); 4°C (working aliquots, ≤1 week)
Freeze-ThawAvoid repeated cycles; aliquot for single-use storage
ReconstitutionUse sterile water; add glycerol (5–50%) for long-term stability

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Surf1; CG9943; SURF1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Surf1
Target Protein Sequence
MIRLGNQMCRQVAFNIQTVFRNPGTANNPRLITRKMTQQRPPVNWTTSIPNQAAKDKEKI APLGWFLLLIPATTFGLGCWQVKRKIWKEQLIKDLNKQLSTAPVALPDDLTDLAQMEYRL VKIRGRFLHDKEMRLGPRSLIRPDGVETQGGLFSQRDSGNGYLIVTPFQLADRDDIVLVN RGWVSRKQVEPETRPLGQQQAEVELTAVVRKGEARPQFTPDHKGNVYLYRDLARMCAATG AAPVFLDAVYDPQTAAHAPIGGQTRVTLRNDHLSYLVTWFSLSAATSFLWYRQIVKRIPF
Uniprot No.

Target Background

Function
Putative involvement in COX complex biogenesis.
Database Links

KEGG: dme:Dmel_CG9943

STRING: 7227.FBpp0076607

UniGene: Dm.1439

Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster SURF1-like protein and how does it relate to human SURF1?

Drosophila melanogaster SURF1-like protein (Surf1) is encoded by the CG9943 gene, which is the Drosophila homolog of the human SURF1 gene. While the vertebrate homolog is part of the surfeit gene cluster, Drosophila Surf genes are dispersed throughout the genome. The Surf1 gene in Drosophila maps to chromosome 3L 65D4, spans 1200 bp, and the 900-bp coding sequence consists of 4 exons. The inferred 300-amino acid protein features a 41-amino acid N-terminal mitochondrial targeting sequence and two transmembrane domains (between amino acids 62-80 and 296-314) . Both human and Drosophila SURF1 proteins are involved in the assembly of cytochrome c oxidase (COX), an essential component of the mitochondrial respiratory chain .

What role does Surf1 play in mitochondrial function?

Surf1 is essential for maintaining mitochondrial function in Drosophila melanogaster, particularly for the proper assembly and function of cytochrome c oxidase (COX, complex IV) of the mitochondrial respiratory chain. Studies have demonstrated that silencing Surf1 expression leads to COX deficiency and impacts oxygen consumption and respiratory reserve in Drosophila cells . The protein is localized to the inner mitochondrial membrane, where it facilitates the assembly of the COX complex. When Surf1 is knocked down, there are severe morphological alterations in mitochondria, as observed by electron microscopy of larval muscles in affected Drosophila .

Why is Drosophila melanogaster used as a model for studying Surf1?

Drosophila offers several advantages as a model organism for studying Surf1 function and its relevance to human disease:

  • The Drosophila Surf1 homolog shares functional similarity with human SURF1

  • Drosophila provides genetic tractability and ease of manipulation

  • The short life cycle allows for rapid experimental progress

  • The ability to target gene silencing to specific tissues using the GAL4/UAS binary system

  • The biochemical and phenotypic changes in Surf1-deficient Drosophila match key features of human Leigh Syndrome

Importantly, Drosophila models of Surf1 deficiency recapitulate the COX-selective impairment seen in human patients with SURF1 mutations, making it a valuable tool for investigating the pathogenic mechanisms of Leigh Syndrome .

How are Surf1 knockdown models generated in Drosophila melanogaster?

Surf1 knockdown models in Drosophila are generated through post-transcriptional silencing using RNA interference technology. The methodology involves the following key steps:

  • Creation of a transgene encoding double-stranded RNA (dsRNA) fragment of the Drosophila Surf1 gene

  • Cloning the fragment into a transformation vector containing UAS (Upstream Activation Sequence) promoter elements

  • P-element mediated transformation of Drosophila embryos with the UAS-Surf1-IR construct

  • Establishing transgenic lines carrying single UAS-Surf1-IR autosomal insertions

  • Using the GAL4/UAS binary system to drive tissue-specific expression of the silencing construct

Specifically, researchers have amplified an 858-bp fragment from the coding sequence of the Drosophila Surf1 gene using PCR, then constructed an inverted repeat separated by a GFP spacer. This was then cloned into the Drosophila transformation vector pUAST to create UAS-Surf1-IR .

The phenotypic consequences of Surf1 knockdown vary depending on the tissue-specificity and developmental timing of silencing:

Ubiquitous knockdown (Actin5C-GAL4):

  • 100% egg-to-adult lethality

  • Small, sluggish larvae with reduced locomotor speed

  • Severely altered mitochondrial morphology in larval muscles

  • The few larvae reaching pupal stage die as early imagos

  • Reduced photoresponsiveness

Neuronal knockdown (elav-GAL4):

  • Viable adults with reduced COX-specific activity in brain sections

  • Impaired optomotor response

  • Abnormal electroretinograms

  • Reduced photoresponsiveness in larvae

  • Behavioral abnormalities

Muscle-specific knockdown (how24B-GAL4):

  • Pupal lethality

  • Developmental arrest during metamorphosis

These diverse phenotypes demonstrate the essential role of Surf1 in multiple tissues, with particularly severe consequences when silenced in muscles or ubiquitously .

How does Surf1 knockdown affect mitochondrial respiratory chain complexes in Drosophila?

The biochemical impact of Surf1 knockdown in Drosophila shows an interesting developmental stage-dependent pattern:

In larvae:

  • Defects in all complexes of the mitochondrial respiratory chain

  • Impairment of F-ATP synthase activity

  • Global mitochondrial dysfunction

In adults:

  • COX-selective impairment (Complex IV)

  • More specific biochemical phenotype matching human Leigh Syndrome patients

In Drosophila S2R+ cells:

  • Selective loss of COX activity

  • Decreased oxygen consumption

  • Reduced respiratory reserve

This developmental difference suggests complex regulatory mechanisms governing mitochondrial respiratory chain assembly during metamorphosis and indicates that different compensatory mechanisms may be active at different developmental stages .

What is the relationship between mitochondrial morphology and Surf1 function?

Studies have revealed significant alterations in mitochondrial morphology in Surf1-deficient Drosophila:

  • Electron microscopy of larval muscles from Actin5C-GAL4 driven Surf1 knockdown individuals shows severely abnormal mitochondrial ultrastructure .

  • The altered morphology may be related to the role of mitochondrial dynamics proteins like Drp1 (dynamin-related protein 1), which is implicated in mitochondrial fission during apoptosis .

  • During normal development, mitochondrial fragmentation is observed during prepupal stages in response to ecdysone pulses, suggesting a link between developmental signaling and mitochondrial dynamics .

  • In Surf1-deficient cells, the balance between mitochondrial fusion and fission may be disrupted, potentially contributing to the observed phenotypes .

The connection between mitochondrial morphology and function underscores the importance of proper mitochondrial dynamics for cellular homeostasis and provides insight into the pathophysiology of Surf1 deficiency .

What molecular mechanisms might explain the differential impact of Surf1 knockdown on respiratory chain complexes in larvae versus adults?

The differential effect of Surf1 knockdown on respiratory chain complexes in larvae versus adults represents an intriguing research question. Several hypotheses might explain this phenomenon:

  • Developmental regulation of mitochondrial assembly factors: Alternative assembly factors may be expressed in a stage-specific manner, with adult flies potentially having Surf1-independent mechanisms for maintaining other respiratory chain complexes while remaining dependent on Surf1 for COX assembly .

  • Metabolic reprogramming during metamorphosis: The profound reorganization of tissues during metamorphosis may reset some aspects of mitochondrial function, potentially allowing for selective recovery of certain complexes but not COX in the absence of Surf1 .

  • Tissue-specific effects: The composition of tissues differs significantly between larvae and adults. The global effect in larvae might reflect the predominance of highly metabolically active tissues with strong dependence on all respiratory chain complexes .

  • Temporal accumulation of damage: The selective COX deficiency in adults may represent the primary effect of Surf1 deficiency, while the broader impact in larvae might reflect secondary metabolic adaptations or stress responses .

Experimental approaches to investigate these hypotheses might include stage-specific proteomics of mitochondrial fractions, metabolic flux analysis, and conditional knockdown systems that can be activated at different developmental stages .

What are the technical challenges in producing and studying recombinant Drosophila Surf1 protein?

Working with recombinant Drosophila Surf1 protein presents several technical challenges:

  • Protein localization and membrane integration: As an inner mitochondrial membrane protein with two transmembrane domains, recombinant Surf1 is difficult to express and purify in a correctly folded, functional state .

  • Post-translational modifications: The protein undergoes processing to remove the 41-amino acid mitochondrial targeting sequence, and may require additional modifications for functionality .

  • Protein-protein interactions: Surf1 functions within the context of multiple protein interactions during COX assembly, which may be difficult to recapitulate in vitro .

  • Functional assays: Developing assays that accurately measure the assembly factor activity of Surf1 requires sophisticated biochemical techniques and potentially intact mitochondria .

  • Structural analysis: The membrane-embedded nature of Surf1 makes structural studies using techniques like X-ray crystallography or cryo-electron microscopy particularly challenging .

Methodological approaches to address these challenges might include using specialized expression systems like baculovirus-infected insect cells, developing novel solubilization and refolding protocols, or creating chimeric proteins that retain functional domains while improving expression and solubility .

How can the Drosophila Surf1 model be utilized to screen for potential therapeutic interventions for Leigh Syndrome?

The Drosophila Surf1 model offers a valuable platform for screening potential therapeutic approaches for Leigh Syndrome:

  • High-throughput screening: The short lifespan and ease of handling make Drosophila suitable for screening large compound libraries for molecules that ameliorate phenotypes associated with Surf1 deficiency .

  • Behavioral readouts: Quantifiable phenotypes like locomotor defects, photoresponsiveness, and electrophysiological abnormalities provide robust endpoints for assessing therapeutic efficacy .

  • Genetic modifier screens: The powerful genetics of Drosophila allows for screening for genetic modifiers that suppress or enhance Surf1 knockdown phenotypes, potentially identifying new therapeutic targets .

  • Metabolic interventions: Testing dietary modifications or metabolic supplements that might bypass the respiratory chain defects or enhance residual COX activity .

  • Tissue-specific rescue experiments: The GAL4/UAS system allows for testing tissue-specific interventions, helping to identify which tissues are critical for therapeutic targeting .

Implementation of such screening approaches would require standardized protocols for phenotypic assessment, statistical methods for handling large datasets, and secondary validation in mammalian models before clinical translation .

What are the key unanswered questions regarding Surf1 function in Drosophila?

Despite significant advances in understanding Surf1 function in Drosophila, several important questions remain:

  • What is the precise molecular mechanism by which Surf1 facilitates COX assembly?

  • Are there developmental stage-specific or tissue-specific interaction partners for Surf1?

  • How does Surf1 deficiency lead to broader mitochondrial dysfunction in larvae but specific COX deficiency in adults?

  • What are the cellular signaling pathways activated in response to Surf1 deficiency?

  • Does Surf1 have additional functions beyond COX assembly, particularly during development?

Addressing these questions will require innovative approaches combining genetics, biochemistry, developmental biology, and systems-level analysis .

How might new technologies advance Surf1 research in Drosophila models?

Emerging technologies offer exciting opportunities to deepen our understanding of Surf1 function:

  • CRISPR/Cas9 genome editing: Creating precise mutations mimicking human pathogenic variants or tagging endogenous Surf1 with reporters for localization studies and protein interaction analyses .

  • Single-cell transcriptomics and proteomics: Characterizing cell type-specific responses to Surf1 deficiency across developmental stages .

  • Advanced imaging techniques: Super-resolution microscopy and correlative light and electron microscopy to visualize mitochondrial dynamics and ultrastructure in Surf1-deficient tissues .

  • Metabolomics: Comprehensive profiling of metabolic alterations in Surf1 knockdown models to identify potential biomarkers and therapeutic targets .

  • Organ-on-chip technology: Creating microfluidic systems with Drosophila cells to model tissue interactions and screen compounds in more physiologically relevant contexts .

Implementation of these technologies could significantly accelerate our understanding of the fundamental biology of Surf1 and facilitate translation to clinical applications for Leigh Syndrome patients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.