Recombinant Drosophila melanogaster Surfeit locus protein 4 homolog (Surf4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Surf4 is synthesized using expression systems optimized for Drosophila melanogaster proteins. Key features include:

  • Amino Acid Sequence: The full-length protein (1–270 residues) includes conserved motifs such as Φ–P–Φ (ER-ESCAPE motif) and a C-terminal dilysine ER localization motif .

  • Expression: Produced in systems like E. coli or HEK293 cells, with tags (e.g., His, Avi, Fc) added during purification .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Table 1: Key Sequence Features

PropertyDetails
Gene NameSurf4 (CG6202 in Drosophila)
Uniprot IDO18405
Molecular Weight~30 kDa (predicted)
Post-Translational ModificationsGlycosylation sites inferred from homologs .

Functional Roles in Intracellular Trafficking

Surf4 operates as a cargo receptor with dual roles:

Anterograde Transport (ER → Golgi)

  • Binds secretory proteins (e.g., proinsulin, progranulin) via their N-terminal ER-ESCAPE motif .

  • Facilitates cargo loading into COPII vesicles or tubular networks .

Retrograde Transport (Golgi → ER)

  • Interacts with α-COP in COPI vesicles via its C-terminal dilysine motif .

  • Deficiency disrupts STING recycling, leading to Golgi accumulation and immune activation .

Table 2: Key Functional Domains

DomainFunction
ER-ESCAPE Binding SiteRecognizes Φ–P–Φ motifs in cargos like growth hormone .
Dilysine MotifMediates COPI binding for retrograde transport .

Cargo-Specific Transport Mechanisms

  • Proinsulin: Surf4 knockdown in pancreatic β-cells reduces insulin secretion and causes ER retention .

  • Progranulin: Essential for lysosomal trafficking; mutations linked to neurodegenerative diseases .

Disease Associations

  • Cancer: Overexpression correlates with poor prognosis in breast cancer and myeloma .

  • Viral Replication: Facilitates hepatitis C virus replication by aiding double-membrane vesicle formation .

Applications in Research

  • Model Organism Studies: Used to dissect ER-Golgi dynamics in Drosophila .

  • Therapeutic Targets: Investigated for modulating insulin secretion or neurodegeneration pathways .

References

  1. Recombinant Surf4 product sheet (CBM15) .

  2. Surf4’s role in cargo trafficking (PMC9929512) .

  3. p24 protein interactions in Drosophila (bioRxiv) .

  4. Evolutionary conservation of Surf4 (PubMed8816471) .

  5. SURF4 in disease mechanisms (CMJ) .

  6. Gene overview (Creative BioMart) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Surf4; Surf-4; CG6202; Surfeit locus protein 4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Surf4
Target Protein Sequence
MSIPNEYIAKTEDVAEQVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSW GCGKFLATVFVLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLR NFALIGALLLVLAEARIEGRSLFAGVPSMGENKPKNFMQLAGRILLAFMFITLIRFELSV WQVIQDIIGSILMVLVVLGYKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFLKYDF FQTLSVIGGLLMIVSLGPGGVSMDEHKKKW
Uniprot No.

Target Background

Function
Endoplasmic reticulum cargo receptor that mediates the export of lipoproteins by recruiting cargos into COPII vesicles to facilitate their secretion.
Database Links

KEGG: dme:Dmel_CG6202

STRING: 7227.FBpp0082571

UniGene: Dm.4798

Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What makes Drosophila melanogaster an ideal model organism for studying Surf4?

Drosophila melanogaster offers several significant advantages for researching proteins like Surf4. The fruit fly's rapid life cycle allows researchers to generate multiple generations in just 10-14 days, enabling efficient genetic crosses and recombination studies . Its fully sequenced genome provides comprehensive genetic context for understanding Surf4 function and regulation. Additionally, the fly's genetic simplicity combined with sophisticated genetic manipulation tools creates an ideal system for protein expression studies .

When designing experiments to study Surf4, researchers should leverage Drosophila's high reproductive rate (females can lay hundreds of eggs) and compact genome. The ability to generate large sample sizes allows for robust statistical analysis when measuring Surf4 expression or phenotypic effects. Moreover, the controlled laboratory environment minimizes variables that might affect protein expression patterns across experimental groups.

How can I generate recombinant Surf4 protein in Drosophila melanogaster?

To generate recombinant Surf4 protein in Drosophila melanogaster, researchers should implement a systematic approach leveraging the fly's genetic recombination machinery. The process begins with designing appropriate DNA constructs containing the Surf4 gene with necessary regulatory elements and tags for detection and purification.

The methodology typically involves:

  • Creating transgenic fly lines carrying the Surf4 construct using P-element-mediated transformation or CRISPR-Cas9 genome editing

  • Validating genomic integration through PCR and sequencing

  • Assessing protein expression levels via Western blotting

  • Optimizing expression conditions by testing different promoters or genetic backgrounds

Importantly, researchers should consider the extreme variation in recombination rates observed across the Drosophila genome when selecting integration sites for the Surf4 construct . Regions with high crossing-over (CO) rates may lead to instability in expression across generations, while regions with more uniform gene conversion (GC) rates might provide more consistent expression . Selecting integration sites within transcript regions may increase accessibility for the recombination machinery, as chromatin accessibility appears to favor double-strand breaks necessary for recombination .

What detection methods are most effective for studying Surf4 expression patterns in Drosophila tissues?

For studying Surf4 expression patterns in Drosophila tissues, researchers should employ a multi-modal approach combining immunohistochemistry, fluorescence microscopy, and quantitative molecular techniques.

The most effective methodological approach includes:

  • Immunohistochemistry with confocal microscopy: Using specific antibodies against Surf4 or against tags engineered into the recombinant protein to visualize cellular localization. This approach works well for fixed tissue samples and provides high-resolution spatial information.

  • Live imaging with fluorescent protein fusions: Generating transgenic flies expressing Surf4 fused to GFP or other fluorescent proteins enables dynamic studies of protein localization and trafficking in living tissues.

  • RT-qPCR and RNA-seq: To quantify mRNA expression levels across different tissues and developmental stages, providing insights into transcriptional regulation.

  • Western blotting: For quantitative assessment of protein levels and potential post-translational modifications.

When implementing these techniques, researchers should consider the genetic background of their Drosophila lines, as intra-specific variation in genetic architecture can influence expression patterns . Additionally, designing controls that account for potential hotspots in recombination landscapes is crucial when comparing expression across different genetic backgrounds .

How do variations in recombination rates across the Drosophila genome affect Surf4 expression studies?

The extreme and highly punctuated variation in recombination rates across the Drosophila genome has profound implications for Surf4 expression studies. Research has revealed that crossing over (CO) rates exhibit significant variation along chromosomes, with distinct hotspots and coldspots at the large scale (100 kb) . This variation can directly impact the stability and inheritance patterns of recombinant Surf4 constructs.

When designing experiments involving recombinant Surf4, researchers should account for:

  • Position effects on transgene expression: Integration of Surf4 constructs into regions with different recombination rates can lead to variable expression patterns. High-resolution recombination maps should be consulted when selecting integration sites .

  • Intra-specific variation: Extensive variation in CO landscapes exists among individuals within the species, often associated with hotspots at low frequency in the population . This necessitates careful selection and characterization of genetic backgrounds for Surf4 studies.

  • Local sequence context: Recombination events are associated with specific sequence motifs and tend to occur within transcript regions . The sequence context surrounding the Surf4 gene may influence recombination frequency and thus affect experimental outcomes.

Based on studies mapping 106,964 recombination events at a resolution down to 2 kilobases in Drosophila melanogaster, researchers should develop strategies to mitigate the effects of variable recombination rates . This might include integrating Surf4 constructs into regions with more predictable recombination behavior or using balancer chromosomes to prevent recombination in specific regions of interest.

What CRISPR-Cas9 strategies are most efficient for modifying the endogenous Surf4 gene in Drosophila melanogaster?

For efficient CRISPR-Cas9 modification of the endogenous Surf4 gene in Drosophila melanogaster, researchers should implement a comprehensive strategy that accounts for the specific characteristics of the Drosophila genome and gene editing machinery.

The optimal methodological approach includes:

  • sgRNA design optimization: Select target sites with minimal off-target effects using Drosophila-specific prediction algorithms. Target sequences within transcript regions may benefit from enhanced chromatin accessibility, which favors double-strand breaks .

  • Delivery method selection: Inject Cas9 protein and sgRNA complexes (ribonucleoproteins) directly into embryos for immediate activity and reduced off-target effects compared to plasmid-based expression.

  • Homology-directed repair (HDR) template design: For precise modifications, design HDR templates with homology arms of 500-1000bp flanking the desired modification. Consider local sequence context and potential recombination hotspots that might affect HDR efficiency .

  • Screening strategy implementation: Develop a robust screening protocol using molecular techniques like PCR, restriction enzyme digests, and sequencing to identify successful edits.

Recent research using Drosophila has demonstrated that genetic tools are now available to manipulate neurons across species, as shown in studies comparing D. melanogaster and D. simulans . This cross-species applicability suggests that CRISPR techniques optimized for D. melanogaster may be adaptable for studying Surf4 homologs in related Drosophila species, enabling comparative functional studies.

How can I resolve conflicting recombination frequency data when mapping Surf4 genetic interactions?

Resolving conflicting recombination frequency data in Surf4 genetic interaction studies requires a systematic approach that accounts for the multiple layers of variation in recombination across the Drosophila genome. The disparity in results may stem from several factors that need methodical investigation.

An effective resolution methodology includes:

  • Genetic background assessment: Analyze whether differences arise from intra-specific variation in recombination landscapes. Research has shown extensive variation in crossing-over patterns among individuals of the same species . Different parental chromosomal arrangements can lead to dramatically different recombination frequencies, as demonstrated in a case where recombination frequencies varied from 0.18 to significantly different values depending on chromosomal organization .

  • Chromosome arrangement verification: Determine the precise arrangement of genetic markers relative to Surf4 in each experimental line. As demonstrated in the example with body color and wing shape genes, different arrangements can lead to opposite results in recombination studies . Specifically, one arrangement might show predominantly parental phenotypes while another might show predominantly recombinant phenotypes.

  • Local recombination landscape characterization: Map the local recombination environment around Surf4 using high-resolution techniques. Consider that:

    • Crossing-over rates vary extremely along chromosomes

    • Gene conversion rates are more uniformly distributed

    • Local sequence motifs influence recombination events

  • Statistical validation: Apply appropriate statistical tests to determine if observed differences are significant or due to chance variation. The example from the literature shows cases where recombinant offspring can appear in higher proportion than parental types due to chance or lethal effects in certain genotypes .

A comprehensive approach would include creating detailed recombination maps around the Surf4 locus using techniques similar to those employed in studies that characterized 5,860 female meioses and mapped over 100,000 recombination events .

What molecular mechanisms govern tissue-specific expression of Surf4 in Drosophila melanogaster?

The molecular mechanisms governing tissue-specific expression of Surf4 in Drosophila melanogaster likely involve a complex interplay of transcriptional regulation, chromatin accessibility, and evolutionarily conserved control elements. While studying these mechanisms, researchers should implement a multi-faceted approach that integrates genomic, transcriptomic, and epigenomic analyses.

A comprehensive methodological strategy includes:

  • Promoter and enhancer analysis: Characterize the regulatory regions upstream and downstream of the Surf4 gene using reporter constructs with tissue-specific markers. Transcript regions are associated with recombination events, suggesting accessible chromatin that may also influence transcriptional activity .

  • Chromatin immunoprecipitation sequencing (ChIP-seq): Identify transcription factors binding to Surf4 regulatory regions in different tissues and developmental stages. This approach can reveal tissue-specific regulatory networks controlling Surf4 expression.

  • ATAC-seq analysis: Map chromatin accessibility across tissues to identify open chromatin regions that may function as tissue-specific regulatory elements for Surf4.

  • Comparative genomics: Analyze conservation of regulatory elements across related Drosophila species to identify evolutionarily conserved control mechanisms. This approach is supported by research demonstrating that even closely related species like D. melanogaster and D. simulans can exhibit significantly different neural responses to the same stimuli, suggesting evolutionary changes in gene regulation .

  • Genetic perturbation experiments: Use CRISPR-Cas9 to systematically modify potential regulatory elements and assess effects on Surf4 expression patterns.

When implementing these approaches, researchers should consider the non-independent layers of variation in recombination and gene expression across the genome . The intricate relationship between chromatin structure, transcriptional activity, and recombination suggests that regions favorable for double-strand breaks (necessary for recombination) may also play roles in tissue-specific gene regulation .

How should control groups be designed when studying recombinant Surf4 phenotypes in Drosophila?

When designing control groups for studies of recombinant Surf4 phenotypes in Drosophila, researchers must implement rigorous methodological approaches that account for the complex genetic background effects and recombination landscape variations inherent to this model organism.

The optimal control group strategy includes:

  • Precise genetic background matching: Generate control lines that differ from experimental lines only in the Surf4 modification of interest. This approach minimizes confounding variables from genetic background differences that might affect recombination rates or expression patterns .

  • Site-specific integration controls: For transgenic Surf4 studies, include controls where the same genomic location is targeted with either:

    • A non-functional Surf4 version (maintaining the same genomic context)

    • An unrelated reporter gene (controlling for position effects)

    • An empty vector (baseline control)

  • Cross-direction controls: Perform reciprocal crosses to control for potential maternal or paternal effects on recombination patterns, as recombination landscapes show individual variation even within the same species .

  • Recombination rate validation: Include genetic markers flanking the Surf4 locus to monitor local recombination rates in both experimental and control groups. This is particularly important given the extreme and punctuated variation in crossing-over rates observed along Drosophila chromosomes .

When analyzing results, researchers should consider that observed phenotypic differences might arise from variations in recombination rates rather than direct effects of Surf4 modification. The extensive intra-specific variation in recombination landscapes documented in Drosophila can lead to unexpected inheritance patterns if not properly controlled .

What statistical approaches best address variability in Surf4 expression data from Drosophila experiments?

To address the inherent variability in Surf4 expression data from Drosophila experiments, researchers should implement tailored statistical approaches that account for the complex sources of variation in this model system.

A comprehensive statistical methodology includes:

  • Mixed-effects modeling: Implement hierarchical models that account for:

    • Fixed effects (experimental treatments or genetic modifications)

    • Random effects (variation between fly lines, genetic backgrounds, or experimental batches)

    • Nested effects (variation within and between experimental replicates)

    This approach is particularly important given the documented intra-specific variation in recombination landscapes that could influence Surf4 expression .

  • Bayesian inference frameworks: Apply Bayesian methods to incorporate prior knowledge about recombination rates and gene expression patterns in Drosophila. This approach is especially valuable when working with complex genetic datasets where multiple factors influence the outcome.

  • Permutation tests for genetic association: When mapping genetic interactions with Surf4, use permutation-based approaches to establish significance thresholds that account for the non-uniform recombination landscape across the Drosophila genome .

  • Power analysis with recombination rate consideration: Calculate required sample sizes based on:

    • Expected effect sizes

    • Known recombination rates in the genomic region of interest

    • Intra-specific variation in recombination patterns

For robust analysis of experimental data, researchers should consider that high-resolution recombination mapping in Drosophila has revealed extreme variation in recombination rates, with some regions showing significantly higher or lower rates than the genomic average . This non-uniform landscape must be accounted for when interpreting genetic association or linkage studies involving Surf4.

How can RNA interference be optimized for studying Surf4 function in specific Drosophila tissues?

Optimizing RNA interference (RNAi) for tissue-specific study of Surf4 function in Drosophila requires a methodical approach that leverages the genetic tools available in this model organism while accounting for potential confounding factors.

The optimal methodology includes:

  • siRNA design strategy:

    • Design multiple siRNAs targeting different regions of Surf4 mRNA

    • Avoid regions with potential off-target effects using Drosophila-specific prediction algorithms

    • Consider the local sequence context and potential secondary structures that might affect RNAi efficiency

    • Validate knockdown efficiency for each siRNA construct independently

  • Delivery system selection:

    • For tissue-specific knockdown, utilize the GAL4-UAS system with appropriate tissue-specific GAL4 driver lines

    • Implement temperature-sensitive GAL80 (GAL80ts) for temporal control of knockdown

    • Consider the recombination landscape when generating stable transgenic lines expressing GAL4 drivers or UAS-RNAi constructs, as recombination rates vary significantly across the genome

  • Knockdown validation approach:

    • Quantify mRNA reduction using RT-qPCR with tissue-specific RNA extraction

    • Verify protein reduction via Western blotting or immunohistochemistry

    • Implement positive controls using RNAi against genes with known visible phenotypes in the target tissue

  • Phenotypic analysis optimization:

    • Design assays specific to the hypothesized function of Surf4

    • Include appropriate genetic background controls that account for potential recombination hotspots

    • Implement controls for potential off-target effects

When interpreting results, researchers should consider that chromatin accessibility favors double-strand breaks , which may influence both recombination events and the efficiency of transgene expression in different genomic locations. This could affect the consistency of RNAi expression across experimental lines if not properly controlled.

How should conflicting data on Surf4 function be interpreted across different experimental approaches?

When confronted with conflicting data on Surf4 function from different experimental approaches in Drosophila, researchers should implement a systematic framework for resolution that accounts for the complex biological and technical factors that may contribute to these discrepancies.

A methodological approach to resolving conflicting data includes:

  • Experimental context evaluation: Analyze key differences in experimental conditions that might explain discrepancies:

    • Genetic background variations (considering the extensive intra-specific variation in recombination landscapes documented in Drosophila)

    • Developmental timing differences (given Drosophila's rapid 10-14 day life cycle)

    • Environmental conditions (temperature, diet, crowding)

    • Technical variations in protein expression or detection methods

  • Genetic interaction assessment: Consider potential genetic interactions specific to each experimental system:

    • Evaluate whether recombination hotspots near the Surf4 locus might affect genetic linkage with modifying loci

    • Test for epistatic interactions that might mask or modify Surf4 phenotypes in certain genetic backgrounds

  • Methodology-specific limitations analysis: Systematically evaluate inherent limitations of each experimental approach:

    • RNAi approaches may have off-target effects or incomplete knockdown

    • Overexpression systems may create neomorphic functions

    • CRISPR-Cas9 edits might have unintended consequences on neighboring regulatory elements

  • Meta-analysis framework: Implement a weighted evaluation system that prioritizes results based on:

    • Methodological rigor and appropriate controls

    • Sample size and statistical power

    • Reproducibility across independent studies or laboratories

    • Consistency with evolutionary conservation data from related Drosophila species

This approach is supported by research showing that even closely related Drosophila species can exhibit dramatically different responses to the same stimuli due to evolutionary changes in neural circuitry , suggesting that protein function may be highly context-dependent and influenced by species-specific genetic architecture.

What bioinformatic pipelines are most effective for analyzing Surf4 genomic data from Drosophila?

For effective analysis of Surf4 genomic data from Drosophila, researchers should implement specialized bioinformatic pipelines that account for the unique genetic architecture and recombination landscape of this model organism.

A comprehensive bioinformatic methodology includes:

  • Genome alignment and variant calling:

    • Use Drosophila-specific reference genomes with accurate annotation of the Surf4 locus

    • Implement variant callers optimized for detecting both SNPs and structural variants

    • Account for regions with extreme recombination rates that might affect mapping quality

    Analysis StageRecommended ToolsKey Parameters
    Read MappingBWA-MEM or Bowtie2Optimize for Drosophila genome size
    Variant CallingGATK or FreeBayesAccount for intra-specific variation
    Structural Variant AnalysisDelly or MantaAdjust for recombination hotspots
  • Recombination-aware linkage analysis:

    • Implement algorithms that account for the highly punctuated variation in recombination rates along Drosophila chromosomes

    • Adjust linkage calculations based on local recombination landscape

    • Consider that recombination events are associated with specific sequence motifs and tend to occur within transcript regions

  • Functional annotation pipeline:

    • Utilize Drosophila-specific gene ontology databases

    • Implement cross-species conservation analysis to identify functionally important Surf4 domains

    • Integrate expression data across tissues and developmental stages

  • Visualization and integration framework:

    • Develop custom visualization tools that overlay Surf4 data with recombination rate maps

    • Implement integrative analysis combining genomic, transcriptomic, and proteomic data

    • Create interactive environments for exploring complex genetic interactions

When implementing these pipelines, researchers should consider that the resolution of recombination mapping in Drosophila has reached 2 kilobases , allowing for highly precise correlation between recombination events and genetic features. This resolution enables sophisticated analysis of how recombination landscape might influence Surf4 expression and function across different genetic backgrounds.

How can evolutionary conservation analysis inform functional studies of Surf4 in Drosophila?

Evolutionary conservation analysis provides powerful insights for functional studies of Surf4 in Drosophila by revealing domains and regulatory elements under selective pressure, suggesting functionally critical regions. A methodological framework for leveraging evolutionary conservation includes:

  • Multi-species sequence comparison approach:

    • Align Surf4 sequences across diverse Drosophila species and other insects

    • Calculate conservation scores at amino acid and nucleotide levels

    • Identify conserved protein domains and potential regulatory elements

    • Map conservation patterns onto protein structural models

    This approach is particularly valuable given that even closely related species like D. melanogaster and D. simulans show important functional differences in neural circuits , suggesting selective pressure on specific protein domains.

  • Regulatory element evolution analysis:

    • Compare promoter and enhancer regions across species

    • Identify conserved transcription factor binding sites

    • Correlate conservation with recombination landscapes, considering that transcript regions are associated with recombination events

  • Positive selection detection methodology:

    • Calculate dN/dS ratios across Surf4 coding sequences

    • Implement site-specific and branch-specific selection analysis

    • Correlate selection patterns with known functional domains

  • Experimental validation strategy:

    • Design targeted mutations in conserved vs. non-conserved regions

    • Test functional consequences using CRISPR-Cas9 precise editing

    • Develop cross-species rescue experiments to test functional conservation

    This approach builds on techniques used in comparative studies of neural circuits between Drosophila species , where genetic tools allowed identification of functionally important differences between species.

When implementing this framework, researchers should consider that recombination itself has profound evolutionary implications, potentially increasing the effectiveness of selection . The interaction between recombination landscapes and conservation patterns might reveal important insights about the evolutionary history and functional constraints on Surf4.

How can single-cell transcriptomics advance our understanding of Surf4 function in Drosophila development?

Single-cell transcriptomics offers unprecedented resolution for studying Surf4 function during Drosophila development, enabling researchers to track expression patterns at cellular resolution across developmental stages and tissues. A comprehensive methodology for applying this technology includes:

  • Developmental time-course experimental design:

    • Isolate single cells from key developmental stages spanning embryonic to adult development

    • Implement protocols optimized for Drosophila tissue dissociation while preserving RNA integrity

    • Use cell-type specific markers to identify and track lineages expressing Surf4

    • Create detailed expression maps that correlate Surf4 levels with developmental trajectories

  • Spatial transcriptomics integration:

    • Combine single-cell RNA-seq with spatial transcriptomics techniques

    • Map Surf4 expression patterns in spatial context across tissues

    • Correlate spatial expression with tissue-specific developmental programs

    • Identify potential morphogenic gradients associated with Surf4 expression

  • Perturbation analysis framework:

    • Apply CRISPR-Cas9 or RNAi to modulate Surf4 expression in specific cell types

    • Perform single-cell RNA-seq on perturbed vs. control samples

    • Identify gene regulatory networks affected by Surf4 modulation

    • Map cellular phenotypes to transcriptional signatures

  • Computational trajectory analysis:

    • Implement pseudotime algorithms to reconstruct developmental trajectories

    • Identify branch points where Surf4 expression influences cell fate decisions

    • Correlate Surf4 expression dynamics with changes in chromatin accessibility

This approach leverages Drosophila's advantages as a model organism, including its rapid development cycle and well-characterized genetics , while accounting for the complex recombination landscape that might influence genetic studies . When designing single-cell experiments, researchers should consider the potential impact of recombination hotspots on transgene expression if using genetic reporters for cell isolation.

What emerging genetic tools show promise for studying Surf4 protein interactions in Drosophila?

Several emerging genetic tools show exceptional promise for studying Surf4 protein interactions in Drosophila, enabling researchers to move beyond traditional approaches and gain deeper insights into protein function in living systems.

A methodological overview of cutting-edge approaches includes:

  • Proximity labeling technologies:

    • Implement BioID or TurboID fusions with Surf4 to identify proximal proteins in living cells

    • Develop split-BioID systems for detecting conditional interactions based on protein proximity

    • Optimize biotin pulse protocols for Drosophila tissues

    • Create tissue-specific expression systems using refined GAL4 drivers

  • Optical control of protein function:

    • Apply optogenetic tools to manipulate Surf4 interactions with temporal precision

    • Develop photo-caged Surf4 variants for localized activation

    • Implement light-inducible protein-protein interaction systems

    • Create optogenetic tools for controlling Surf4 subcellular localization

    This approach builds on techniques recently developed for neural circuit manipulation in Drosophila species , where sophisticated genetic tools allowed precise control of neuron activity.

  • In vivo structural analysis:

    • Implement split-fluorescent protein complementation to visualize Surf4 interactions

    • Develop FRET/FLIM sensors for detecting Surf4 conformational changes

    • Apply advanced microscopy techniques for single-molecule tracking in living flies

    • Create nanobody-based sensors for detecting Surf4 states in vivo

  • Synthetic genetic interaction screening:

    • Design CRISPR interference (CRISPRi) libraries for systematic interaction screening

    • Implement synthetic genetic array (SGA) approaches adapted for Drosophila

    • Develop combinatorial genetic perturbation systems

    • Create tissue-specific genetic interaction maps

When implementing these approaches, researchers should consider the complex recombination landscape of Drosophila, which exhibits extreme variation along chromosomes . Strategic selection of genomic integration sites for transgenes expressing these tools can help ensure consistent expression and reliable results across experimental replicates.

How might synthetic biology approaches revolutionize Surf4 research in Drosophila systems?

Synthetic biology approaches offer transformative potential for Surf4 research in Drosophila systems by enabling precise control over protein expression, function, and interaction networks. A comprehensive methodological framework for applying synthetic biology to Surf4 research includes:

  • Designer Surf4 variant library creation:

    • Develop a systematic library of Surf4 variants with domain deletions, substitutions, and fusions

    • Implement landing pad technology for consistent genomic integration

    • Create orthogonal expression systems with minimal crosstalk to endogenous pathways

    • Design synthetic protein scaffolds to control Surf4 localization and interaction partners

    Variant TypeDesign StrategyExpected Utility
    Domain deletionsSequential removal of conserved domainsMap domain-specific functions
    Point mutationsTarget evolutionarily conserved residuesIdentify critical amino acids
    Fusion proteinsAttach reporters or control modulesMonitor localization and activity
    Synthetic switchesAdd ligand-dependent control elementsAllow temporal manipulation
  • Genetic circuit design for Surf4 regulation:

    • Implement synthetic transcriptional regulators to control Surf4 expression

    • Design feedback loops for homeostatic control of Surf4 levels

    • Create multi-input logic gates for tissue-specific expression patterns

    • Develop oscillatory circuits to study Surf4 dynamics

  • Orthogonal translation systems:

    • Incorporate unnatural amino acids into Surf4 for novel functionalities

    • Develop orthogonal tRNA/synthetase pairs optimized for Drosophila

    • Create chemically-controlled protein stability systems

    • Implement riboswitch technology for post-transcriptional control

  • Genome-scale engineering platforms:

    • Develop multiplexed CRISPR systems for simultaneous editing of Surf4 and interacting genes

    • Create synthetic chromosomes carrying engineered Surf4 variants

    • Implement gene drive systems for rapid population-level genetic modifications

    • Design synthetic genetic interaction networks to probe Surf4 function

When implementing these approaches, researchers should consider the unique advantages of Drosophila, including its rapid life cycle and genetic tractability , while accounting for the complex recombination landscape that might influence the stability of synthetic genetic constructs . Strategic positioning of synthetic elements relative to known recombination hotspots and coldspots could enhance experimental reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.