Recombinant Drosophila melanogaster Threonylcarbamoyladenosine tRNA methylthiotransferase (CG6550)

Shipped with Ice Packs
In Stock

Description

Functional Role in tRNA Modification

CG6550 catalyzes the methylthiolation of N⁶-threonylcarbamoyladenosine (t⁶A) at position 37 of tRNA, forming 2-methylthio-N⁶-threonylcarbamoyladenosine (ms²t⁶A³⁷). This modification is essential for:

  • Anticodon stability: Enhances tRNA binding to ribosomes during translation .

  • Wobble codon recognition: Facilitates accurate decoding of lysine codons (AAA/AAG) in mRNA .

  • Insulin biosynthesis: In D. melanogaster, CG6550-deficient cells show reduced mature insulin secretion despite elevated precursor mRNA levels .

Expression System

  • Host: E. coli

  • Tag: His tag for affinity chromatography .

  • Form: Lyophilized powder with >90% purity .

Research Applications

  • Mechanistic studies: Investigating tRNA modification pathways and their impact on translational fidelity .

  • Disease modeling: Links to type 2 diabetes (T2DM) via homology to human CDKAL1, a T2DM risk gene .

  • Enzymatic assays: Quantifying methylthiotransferase activity in vitro .

Role in Insulin Regulation

  • Silencing CG6550 in D. melanogaster reduces mature insulin by 30% despite increased precursor mRNA levels .

  • The ms²t⁶A³⁷ modification stabilizes tRNAᴸʸˢ³ interactions with lysine codons in insulin mRNA, preventing translational errors .

Implications for Human Health

  • Diabetes risk: CG6550 homologs (e.g., human CDKAL1) are associated with impaired insulin processing and T2DM susceptibility .

  • Aging research: tRNA modifications, including ms²t⁶A³⁷, correlate with age-related declines in protein synthesis fidelity .

Future Research Directions

  • Structural biology: High-resolution crystallography to map substrate-binding domains.

  • Therapeutic targeting: Screening small molecules to modulate methylthiotransferase activity in metabolic disorders.

  • Evolutionary studies: Comparing CG6550 orthologs across insect species to trace functional conservation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
CG6550; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDKAL1-like protein; tRNA-t(6A37 methylthiotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG6550
Target Protein Sequence
MYHLGQDLPGNDVDDIEDLISADDVKPRERYENKKTVTVRAKKRSQIRLESQEEEEKPKP TIHESVIPGTQKVFVKTWGCAHNNSDSEYMAGQLAAYGYRLSGKEEADLWLLNSCTVKNP SEDTFRNEIESGMRNGKHVVVAGCVPQGAPKSDYLNGLSVIGVQQIDRVVEVVEETLKGH SVQLLQNKKKVHGRRVAGAPLSLPKVRKNPLIEIISINSGCLNQCTYCKTKHARGDLASY PPEEVVERARQSFAEGCCEIWLTSEDTGAYGRDIGSSLPELLWQLVEVIPEHCMLRVGMT NPPYILEHLEEVANVLQHPRVYSFLHVPVQSGSDSVLGEMKREYCRQDFEHVVDFLRERV PGVTIATDIICGFPTETEDDFEETMTLCAKYRFPSLFINQFFPRPGTPAAKMDRIPANLV KKRTKRLTDLFYSYEPYADRVGEIYTVLVTEVSHDKLHYVGHNKSYEQVLLPMRDNLLGT RVHVRITSASKFSMVGEILDDERDWTRCAKNQELPNVQVQTRSRERLIQRYFGIALVLGS LAFLIQLVVRLL
Uniprot No.

Target Background

Function
This enzyme catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), resulting in the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that read codons beginning with adenine.
Database Links

KEGG: dme:Dmel_CG6550

STRING: 7227.FBpp0086116

UniGene: Dm.4535

Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the primary function of Drosophila melanogaster threonylcarbamoyladenosine tRNA methylthiotransferase (CG6550)?

Drosophila melanogaster threonylcarbamoyladenosine tRNA methylthiotransferase (CG6550) catalyzes the formation of threonylcarbamoyladenosine (t6A), a universal modification located in the anticodon stem-loop of tRNAs. This modification is crucial for maintaining translation fidelity during protein synthesis in both cytoplasmic and mitochondrial tRNAs .

The enzyme functions within a multi-step pathway that typically involves:

  • Formation of a threonyl-carbamoyl-AMP intermediate (TC-AMP)

  • Transfer of the threonyl-carbamoyl moiety from TC-AMP to tRNA to form threonylcarbamoyladenosine

Based on homology to yeast systems, CG6550 likely participates in a complex with other proteins to facilitate this modification, which is essential for accurate decoding during translation.

How conserved is the threonylcarbamoyladenosine modification pathway across species?

Research demonstrates remarkable cross-kingdom functional conservation of the core components involved in threonylcarbamoyladenosine synthesis. The pathway shows high conservation from bacteria to eukaryotes, including Drosophila .

Key evidence for this conservation includes:

  • The universal presence of threonylcarbamoyladenosine modification in tRNAs across all domains of life

  • Successful heterologous complementation experiments, where yeast mitochondrial threonylcarbamoyladenosine enzymes (Qri7p and Sua5p) can functionally complement the essentiality of Escherichia coli tsaD mutants

  • Conserved reaction mechanisms involving the formation of threonyl-carbamoyl-AMP intermediate (TC-AMP) followed by transfer to tRNA

This high degree of conservation suggests that studying CG6550 in Drosophila may provide insights applicable to understanding homologous pathways in other organisms, including humans.

What expression systems are most effective for producing functional recombinant CG6550?

Based on data from similar Drosophila recombinant proteins, researchers should consider multiple expression systems when producing CG6550:

Expression SystemAdvantagesConsiderationsCode Examples
Escherichia coliHigh yield, cost-effective, rapid expressionMay lack post-translational modificationsCSB-EP309352DLU
YeastEukaryotic system with some post-translational modificationsModerate yield, longer expression timeCSB-YP309352DLU
BaculovirusInsect-derived system with appropriate post-translational modificationsHigher cost, technically demandingCSB-BP309352DLU
Mammalian cellsComplete post-translational modificationsHighest cost, lower yieldsCSB-MP309352DLU

For functional studies requiring proper folding and post-translational modifications, baculovirus expression systems may be particularly appropriate for insect proteins. Biotinylation strategies (such as AviTag-BirA technology) can be employed for specific applications requiring tagged protein .

How should I design purification strategies for recombinant CG6550?

Effective purification of recombinant CG6550 requires a multi-step approach:

  • Affinity tag selection:

    • Consider a biotinylated AviTag approach, which allows for site-specific biotinylation via BirA ligase

    • His-tags or GST-tags may be suitable alternatives depending on downstream applications

  • Sequential chromatography steps:

    • Primary capture: Affinity chromatography based on the chosen tag

    • Intermediate purification: Ion exchange chromatography to remove contaminants

    • Polishing: Size exclusion chromatography for final purity and buffer exchange

  • Quality control assessments:

    • SDS-PAGE for purity verification

    • Western blotting for identity confirmation

    • Mass spectrometry for molecular weight verification

    • Activity assays to confirm functional integrity

When designing purification protocols, researchers should consider that tRNA modifying enzymes often require cofactors such as S-adenosylmethionine (SAM) or S-adenosylhomocysteine (SAH) , which may influence stability during purification.

What are the optimal assay conditions for measuring CG6550 enzymatic activity?

Based on studies of related tRNA modification enzymes, the following parameters should be considered when establishing CG6550 activity assays:

  • Substrate preparation:

    • Purified tRNA substrates (either native or in vitro transcribed)

    • S-adenosylmethionine as methyl donor

    • Preparation of threonyl-carbamoyl-AMP intermediate if studying specific reaction steps

  • Reaction conditions optimization:

    • Buffer composition (typically 50-100 mM Tris or HEPES, pH 7.5-8.0)

    • Divalent cation requirements (Mg2+, Mn2+)

    • Temperature optimization (25-37°C)

    • Incubation time determination (typically 30-60 minutes)

  • Activity detection methods:

    • Mass spectrometry to detect modified nucleosides

    • HPLC analysis of nucleoside content after enzymatic digestion

    • Radioactive labeling using [3H]-SAM or [35S]-SAM

When establishing these assays, it's important to consider that the threonylcarbamoyladenosine synthesis reaction appears to involve intermediate channeling between enzyme components , suggesting that reconstituting the full activity may require multiple protein components.

How can I determine the subcellular localization of CG6550 in Drosophila cells?

Determining the subcellular localization of CG6550 requires multiple complementary approaches:

  • Bioinformatic prediction:

    • Analysis of potential targeting sequences (mitochondrial, nuclear, etc.)

    • Comparison with homologs such as yeast Sua5p, which uses alternative start sites to target both cytoplasm and mitochondria

  • Experimental localization techniques:

    • Fluorescent protein fusion constructs (GFP-CG6550) for live cell imaging

    • Immunofluorescence using antibodies against CG6550 or epitope tags

    • Subcellular fractionation followed by Western blotting

  • Functional validation:

    • Rescue experiments with constructs targeted to specific compartments

    • Mutational analysis of predicted targeting sequences

Based on findings in yeast, where Sua5p (involved in threonylcarbamoyladenosine synthesis) is targeted to both cytoplasm and mitochondria through alternative start sites , researchers should carefully analyze potential dual localization of CG6550, as both cytoplasmic and mitochondrial tRNAs undergo threonylcarbamoyladenosine modification.

How does the structure of CG6550 determine its substrate recognition and catalytic mechanism?

While specific structural data for CG6550 is not directly available in the search results, insights can be derived from related tRNA modifying enzymes:

  • Domain architecture considerations:

    • CG6550 likely contains a methyltransferase domain for SAM binding

    • RNA-binding domain features that recognize the anticodon stem-loop

    • Potential protein-protein interaction domains for complex formation

  • Substrate recognition mechanisms:

    • Related tRNA modifying enzymes (such as METTL6) show extensive remodeling of the anticodon arm and global bending of tRNA toward the enzyme

    • The target nucleoside (adenosine) likely undergoes base flipping, similar to what occurs with cytosine 32 in METTL6-catalyzed modifications

    • Disruption of base pairs within the anticodon loop may be required for access to the modification site

  • Catalytic mechanism:

    • The reaction likely involves sequential steps with the formation of threonyl-carbamoyl-AMP intermediate before transfer to tRNA

    • The enzyme may induce conformational changes in tRNA similar to the "flip-out mechanism" described for other RNA-modifying enzymes

Structural studies of CG6550, potentially using cryo-electron microscopy approaches similar to those used for METTL6 , would significantly advance understanding of its specific recognition and catalytic mechanisms.

What protein complexes does CG6550 form during threonylcarbamoyladenosine synthesis in Drosophila?

Based on information about threonylcarbamoyladenosine synthesis pathways in other organisms, CG6550 likely functions within a protein complex:

  • Potential complex components:

    • In yeast, cytoplasmic threonylcarbamoyladenosine synthesis requires Sua5p, Kae1p, and four other KEOPS complex proteins

    • The mitochondrial pathway in yeast involves just two proteins: Sua5p and Qri7p (a Kae1p/TsaD family member)

    • Drosophila likely contains homologs of these components forming similar complexes

  • Evidence for functional interactions:

    • Heterologous complementation studies suggest intermediate channeling between components

    • The co-expression of both enzymes (Qri7p and Sua5p) was required to complement E. coli tsaD mutants, indicating functional interaction

  • Complex formation investigation approaches:

    • Co-immunoprecipitation with tagged CG6550

    • Proximity labeling approaches (BioID, APEX)

    • Size-exclusion chromatography to identify native complexes

    • Cryo-EM structural analysis of reconstituted complexes

Understanding these protein-protein interactions is crucial, as the research indicates that the threonylcarbamoyladenosine synthesis pathway may involve channeling of intermediates between enzymes rather than release of intermediates into solution .

How does CG6550 dysfunction impact translation fidelity and proteome integrity in Drosophila?

Disruption of CG6550 function would likely have significant consequences for translation and proteome integrity:

  • Direct translation effects:

    • Impaired decoding of codons that rely on threonylcarbamoyladenosine-modified tRNAs

    • Increased translational frameshifting and misreading errors

    • Altered translation rates at specific codons

  • Downstream proteome effects:

    • Accumulation of mistranslated proteins leading to proteotoxic stress

    • Activation of protein quality control mechanisms (chaperones, proteasome)

    • Potential mitochondrial dysfunction if mitochondrial tRNA modification is affected

  • Physiological consequences:

    • Development defects if translation is impaired during critical growth phases

    • Tissue-specific phenotypes based on differential requirements for translation fidelity

    • Potential genetic interaction with population dynamics in small Drosophila populations

  • Experimental approaches:

    • Ribosome profiling to measure translation fidelity at specific codons

    • Proteomics to identify mistranslated proteins

    • Reporter constructs to quantify frameshifting and misreading rates

Given the universal nature of threonylcarbamoyladenosine modification and its conservation across species , dysfunction of CG6550 would likely have profound effects on cellular physiology through widespread translation defects.

What strategies can address protein insolubility when expressing recombinant CG6550?

Researchers encountering solubility issues with CG6550 should consider these approaches:

  • Expression system adjustments:

    • Testing multiple host systems (E. coli, yeast, baculovirus, mammalian cells)

    • Reducing expression temperature (16-20°C)

    • Using specialized E. coli strains (Rosetta, Arctic Express, SHuffle)

  • Construct optimization:

    • Domain-based constructs focusing on functional regions

    • Solubility-enhancing fusion tags (MBP, SUMO, thioredoxin)

    • Removal of hydrophobic regions predicted to cause aggregation

  • Buffer screening:

    • Systematic pH screening (typically pH 6.0-9.0)

    • Salt concentration optimization (100-500 mM NaCl)

    • Addition of stabilizing agents (glycerol, arginine, trehalose)

    • Including cofactors (SAM/SAH) that may stabilize the protein structure

  • Co-expression strategies:

    • Co-expression with protein partners identified from complex studies

    • Co-expression with molecular chaperones to aid folding

Since CG6550 may function in a complex with other proteins , co-expression with its natural binding partners might significantly improve solubility and stability.

How can I troubleshoot inconsistent enzymatic activity in CG6550 preparations?

When facing variable activity results with recombinant CG6550, consider these potential issues:

  • Enzyme quality factors:

    • Protein degradation during purification (add protease inhibitors)

    • Loss of cofactors during purification (supplement with SAM/SAH)

    • Oxidation of critical residues (include reducing agents)

    • Aggregation state (verify by dynamic light scattering or size exclusion)

  • Substrate considerations:

    • tRNA substrate quality and structural integrity

    • Presence of inhibitory contaminants

    • Batch-to-batch variation in substrate preparation

  • Reaction condition variables:

    • Metal ion requirements (Mg2+, Mn2+, Zn2+)

    • pH sensitivity (assess activity across pH range)

    • Temperature dependence

    • Time course optimization

  • Detection method limitations:

    • Sensitivity thresholds of analytical methods

    • Signal-to-noise ratio in assay readouts

    • Linear range limitations of detection systems

Research on the threonylcarbamoyladenosine pathway indicates that the reaction involves intermediate channeling between enzyme components , suggesting that reconstituting full activity may require multiple protein components rather than CG6550 alone.

What controls are essential when studying CG6550 function in Drosophila populations?

When designing experiments to study CG6550 in Drosophila, include these critical controls:

  • Genetic background controls:

    • Use isogenic backgrounds to minimize variation

    • Include heterozygous controls to assess dosage effects

    • Perform rescue experiments with wild-type CG6550 to confirm phenotype specificity

  • Population-level controls:

    • Maintain consistent population sizes (16-32 flies per culture is standard in population studies)

    • Control for generational effects by sampling at consistent timepoints (10-14 days)

    • Consider establishing population cages for long-term studies

  • Environmental controls:

    • Standardize culture medium composition

    • Maintain consistent temperature and humidity

    • Control timing of sample collection (specific day after mating)

  • Molecular verification controls:

    • Confirm mutation/knockdown efficiency at mRNA and protein levels

    • Verify impact on threonylcarbamoyladenosine modification levels

    • Include positive controls with known tRNA modification defects

The importance of rigorous controls is highlighted by studies showing that even small population variations can lead to significant genetic drift effects in Drosophila experiments .

How can CG6550 be used as a tool to study translation regulation during Drosophila development?

CG6550 offers several research applications for investigating translation regulation:

  • Developmental stage-specific studies:

    • Creation of conditional CG6550 mutants to analyze stage-specific requirements

    • Quantification of threonylcarbamoyladenosine levels across developmental stages

    • Correlation of modification levels with translation rates of specific mRNAs

  • Tissue-specific translation analysis:

    • Tissue-specific knockdown of CG6550 using GAL4-UAS system

    • Comparison of translation profiles between wild-type and CG6550-deficient tissues

    • Analysis of cell-autonomous vs. non-autonomous effects of translation defects

  • Stress response investigations:

    • Examination of how threonylcarbamoyladenosine modification responds to environmental stressors

    • Analysis of translation adaptation mechanisms under CG6550 limiting conditions

    • Investigation of compensatory pathways activated when tRNA modification is impaired

  • Evolutionary perspectives:

    • Comparative analysis of CG6550 function across Drosophila species

    • Investigation of codon usage bias in relation to threonylcarbamoyladenosine-dependent decoding

These approaches leverage the critical role of threonylcarbamoyladenosine in translation fidelity to provide insights into regulatory mechanisms controlling protein synthesis during development.

What experimental designs can distinguish direct targets from indirect effects of CG6550 dysfunction?

To differentiate primary effects of CG6550 dysfunction from secondary consequences:

  • Temporal analysis approaches:

    • Time-course experiments following CG6550 inactivation

    • Acute vs. chronic depletion comparisons

    • Early developmental stage analysis before compensatory mechanisms activate

  • Molecular profiling strategies:

    • Direct measurement of threonylcarbamoyladenosine levels in specific tRNAs

    • Ribosome profiling to identify codon-specific translation defects

    • Proteomics to identify mistranslated proteins appearing immediately after CG6550 inactivation

  • Targeted rescue experiments:

    • Structure-function analysis with mutant CG6550 variants

    • Cross-species complementation with CG6550 homologs

    • Bypass experiments by supplying downstream products or activating compensatory pathways

  • Systems biology approaches:

    • Network analysis to distinguish primary from secondary nodes

    • Mathematical modeling of translation fidelity with and without threonylcarbamoyladenosine modification

    • Integration of multi-omics data to map direct and indirect effects

Cross-kingdom complementation studies provide particularly valuable approaches for distinguishing direct functions, as demonstrated by the ability of yeast threonylcarbamoyladenosine pathway enzymes to functionally complement E. coli mutations .

How might structural studies of CG6550 advance understanding of tRNA modification mechanisms?

Structural characterization of CG6550 would provide multiple research benefits:

  • Mechanistic insights:

    • Determination of substrate binding pocket architecture

    • Identification of catalytic residues involved in the methylthiotransferase reaction

    • Understanding conformational changes during catalysis

  • Structure-guided approaches:

    • Design of specific inhibitors or activity modulators

    • Creation of separation-of-function mutations for in vivo studies

    • Engineering enzymes with altered specificity

  • Complex assembly understanding:

    • Visualization of protein-protein interactions within the threonylcarbamoyladenosine synthesis complex

    • Identification of interaction interfaces for functional studies

    • Understanding how intermediates are channeled between components

  • Evolutionary perspectives:

    • Structural comparison with homologs across species

    • Identification of conserved vs. divergent features

    • Understanding of adaptation to different cellular environments

Recent cryo-electron microscopy studies of related tRNA modification enzymes (such as METTL6 with SerRS and tRNA) demonstrate the power of structural approaches for understanding tRNA modification mechanisms, particularly how these enzymes induce conformational changes in their tRNA substrates to access modification sites.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.