Recombinant Drosophila melanogaster TM2 domain-containing protein almondex (amx)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
amx; CG12127; TM2 domain-containing protein almondex
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-284
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
amx
Target Protein Sequence
ASGGNQMDLSDSKGDHKDNSNASNGNGNANDNEVYVPPLVSSMVAKSGGGAGGLLDNITA YSSSSSSSSSNGNNNMLCPYDKETPCDRLQFPCIRCNYNHGCIYGRDLNVTCEVINNVQC LGERSFQRQMNCRYCYQTEMWQQSCGQRSSCNSATDKLFRTNCTVHHDVLCLGNRSFTRN LRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTIIDVLLISM HYLGPADGSLYI
Uniprot No.

Target Background

Function
This protein is involved in regulating cell fate within the neurectoderm. It functions as a positive regulator of the Notch signaling pathway and is essential at various developmental stages.
Gene References Into Functions
  1. Studies have demonstrated that human TM2D3, expressed under the control of endogenous Drosophila amx regulatory elements, can rescue the embryonic neurogenic phenotype. This indicates that Amx and TM2D3 are orthologs with conserved in vivo molecular functions. PMID: 27764101
  2. Molecular data reveal that amx is ubiquitously expressed and encodes a conserved putative transmembrane protein with several domains differentially required for its function in Drosophila. PMID: 18331889
Database Links

KEGG: dme:Dmel_CG12127

UniGene: Dm.1883

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is almondex (amx) and what is its role in Drosophila development?

Almondex (amx) is a maternal-effect neurogenic gene in Drosophila melanogaster that encodes an evolutionarily conserved double-pass transmembrane protein. It was first identified in the 1970s and plays crucial roles in embryonic development, particularly in neurogenesis . The amx gene is essential for proper Notch signaling during early Drosophila embryogenesis.

The protein contains a signal sequence for membrane localization and a highly conserved Transmembrane 2 (TM2) domain . While homozygous or hemizygous amx mutant females and hemizygous males are viable with no obvious morphological abnormalities, embryos from amx-deficient mothers exhibit severe developmental defects, including expansion of the nervous system at the expense of epidermal tissue (neurogenic phenotype) .

How is the function of amx related to Notch signaling pathways?

Almondex functions as a positive regulator of Notch signaling through multiple mechanisms:

  • Surface presentation of Notch receptors: TM2D3, the mammalian homolog of Drosophila amx, physically associates with Notch1 and enhances its expression on the cell surface .

  • Receptor distribution: Amx is required for proper subcellular Notch receptor distribution in the neuroectoderm during mid-stage 5 development. The absence of maternal amx causes Notch to accumulate abnormally in cells in a mesh-like pattern .

  • Endocytosis facilitation: Amx-deficient Drosophila embryos exhibit impaired endocytosis of NECD (Notch extracellular domain) and Delta ligand, a process required for Notch activation .

  • Multiple Notch-dependent processes: Amx is necessary for lateral inhibition in the neuroectoderm and partially required for Notch signaling-dependent single-minded expression in the mesectoderm .

What phenotypes are associated with amx mutations in Drosophila?

Amx mutations result in several distinct phenotypes across developmental stages:

  • Embryonic neurogenic phenotype: Embryos from amx-deficient mothers show hyperplasia of the developing embryonic nervous system at the expense of developing ventral epidermis, indicating loss of Notch signaling .

  • Maternal-effect embryonic lethality: This can be quantified through egg hatching assays. Genomic rescue constructs (wild-type amx, 3xHA::amx, or human TM2D3) can suppress this embryonic lethality .

  • Adult lifespan reduction: amxΔ animals have reduced lifespan compared to controls. Expression of human TM2D3 partially rescues this phenotype, while restoring Amx expression specifically in neuronal cells fully rescues the reduced lifespan .

  • Age-dependent neurophysiological defects: While 5-day-old amxΔ mutants show normal or slightly affected responses in tergotrochanteral (TTM) and dorsal longitudinal (DLM) muscles, 25-day-old mutants exhibit significantly reduced responses in both muscle groups .

What are the mammalian homologs of Drosophila almondex?

The mammalian homolog of Drosophila almondex is transmembrane 2 (TM2) domain containing 3 (TM2D3) . This evolutionary conservation extends to functional properties:

  • Structural conservation: Both proteins contain an N-terminal signal peptide and two potential transmembrane domains at the C-terminal region .

  • Functional conservation: Human TM2D3 expressed under the regulatory elements of fly amx can significantly suppress the maternal-effect neurogenic phenotype of amx hemizygous females .

  • TM2D family members: TM2D3 belongs to a family that also includes TM2D1 and TM2D2, whose Drosophila orthologs are biscuit (bisc) and amnesiac-related (amrt), respectively .

  • Disease relevance: Rare variants in human TM2D3 are associated with late-onset Alzheimer's disease (LOAD) and possibly early-onset Alzheimer's disease (EOAD) or frontotemporal dementia .

What experimental approaches are most effective for studying amx function in vivo?

Several complementary approaches have proven effective for studying amx function:

  • CRISPR-based gene editing: Generation of clean null alleles (amxΔ) has enabled precise phenotypic characterization. This approach produces phenotypes indistinguishable from classic mutant alleles (amx1) but with defined molecular lesions .

  • Genomic rescue constructs: Wild-type amx, epitope-tagged versions (3xHA::amx), and human TM2D3 constructs expressed under native regulatory elements can rescue amx mutant phenotypes to varying degrees, allowing assessment of structure-function relationships .

Rescue ConstructEmbryonic Lethality Suppression
amxΔ (control)~10% hatching
amxΔ + amx~80% hatching
amxΔ + 3xHA::amx~80% hatching
amxΔ + TM2D3~60% hatching
  • Tissue-specific expression: Using the GAL4-UAS system to restore Amx expression specifically in neuronal cells can rescue lifespan defects, enabling tissue-specific function analysis .

  • Electrophysiological recordings: The giant fiber system provides a robust assay for characterizing age-dependent neurophysiological defects in amx mutants .

  • "Humanizing" Drosophila with human variants: Expressing human TM2D3 variants (e.g., p.P155L) in amx mutant backgrounds allows functional assessment of disease-associated variants .

How do null mutations in amx affect Notch receptor trafficking?

Amx plays a critical role in regulating Notch receptor trafficking:

  • Temporal specificity: The effect on Notch distribution is temporally specific to mid-stage 5 development in the neuroectoderm .

  • Abnormal accumulation pattern: In the absence of maternal amx, Notch accumulates abnormally in a mesh-like pattern within cells .

  • Specificity to Notch: The trafficking defect appears specific to Notch receptors, as there is no obvious change in subcellular Delta ligand distribution, suggesting it does not result from a general vesicular-trafficking defect .

  • Functional consequence: TM2D3/amx enhances expression of Notch receptors on the cell surface. In Tm2d3-deficient cells, cell surface expression of Notch1 and Notch2 is reduced .

  • Endocytosis requirement: Amx-deficient Drosophila embryos exhibit impaired endocytosis of NECD and Delta ligand, for which surface presentation of Notch is required .

The data suggests that amx facilitates Notch activation by regulating intracellular Notch receptor distribution during early embryogenesis, which is essential for proper signal transduction.

What molecular mechanisms underlie amx regulation of Notch signaling?

The molecular mechanisms by which amx regulates Notch signaling involve several key processes:

  • Physical association: TM2D3/amx physically associates with Notch1 at a region distinct from the ligand-binding domain .

  • Domain requirements: Activation of Notch1 by TM2D3 requires:

    • The ligand-binding domain in Notch1

    • The C-terminal region containing the TM2 domain in TM2D3/amx

  • Surface presentation enhancement: TM2D3/amx enhances expression of Notch1 on the cell surface, which is critical for receptor-ligand interactions and subsequent signal transduction .

  • Endocytosis facilitation: Amx facilitates endocytosis of NECD and Delta ligand following receptor-ligand interaction, a prerequisite process for the conformational change of the membrane proximal region of Notch necessary to induce critical proteolytic cleavages for activation .

  • Contextual regulation: Amx appears to fine-tune Notch signaling in specific developmental contexts rather than functioning as a core component of the pathway .

How can Drosophila amx models be used to study human TM2D3 variants associated with Alzheimer's disease?

Drosophila amx provides a valuable model system for functional characterization of human TM2D3 variants:

  • Functional conservation testing: The maternal-effect neurogenic phenotype of amx hemizygous females can be significantly suppressed by introducing reference human TM2D3 expressed under fly amx regulatory elements, demonstrating functional conservation .

  • Variant pathogenicity assessment: While reference TM2D3 rescues amx phenotypes, disease-associated variants like TM2D3 p.P155L fail to do so, providing strong evidence for functional impairment .

  • Workflow for variant characterization:

    • Informatic analysis using human and model organism databases

    • Generation of "humanized" Drosophila expressing human TM2D3 variants

    • Phenotypic assessment of maternal-effect neurogenic phenotype

    • Lifespan and neurophysiological testing in adult flies

  • Disease mechanism insights: This approach has revealed that the molecular function of TM2D3 relevant to Alzheimer's disease may be related to Notch signaling, providing new mechanistic insights .

  • Expansion to other variants: This methodology has been applied to additional variants (e.g., p.P69L) identified in early-onset Alzheimer's disease or frontotemporal dementia patients .

What is the functional significance of TM2D gene redundancy in Drosophila?

Research on TM2D gene family members reveals complex functional relationships:

  • Triple null mutant phenotype: TM2D triple null mutant flies (amxΔ amrtΔ biscΔ) are phenotypically similar to single null mutants (amxΔ), exhibiting a neurogenic phenotype in embryos but no overt morphological phenotypes in adults .

  • Double mutant comparison: amxΔ amrtΔ double mutants also exhibit a neurogenic phenotype comparable to single mutants, suggesting non-additive effects .

  • Normal adult structures: Despite embryonic phenotypes, head structures, wings, and thorax of TM2D double and triple null mutants appear normal compared to controls .

  • Functional specificity: The TM2 domain alone is a potent inhibitor of Notch signaling, suggesting this highly conserved domain is central to the function of all family members .

  • Evolutionary divergence: While the three TM2D genes share functional properties in embryonic development, they may have diverged to acquire distinct roles in other contexts or developmental stages .

This pattern suggests that while the TM2D family members share core functional properties related to Notch signaling during embryogenesis, they may have evolutionarily diverged to acquire more specialized roles in other contexts.

What expression systems are optimal for producing recombinant Drosophila amx protein?

For efficient production of recombinant Drosophila amx protein, insect cell-based expression systems offer several advantages:

  • Baculovirus expression systems: These powerful and versatile delivery vehicles can produce high levels of recombinant protein in insect cells (up to 500 mg/L) .

  • Drosophila expression system (DES): This system uses Drosophila Schneider S2 cells and simple expression vectors to allow stable or transient expression of recombinant proteins with proper post-translational modifications .

SystemHostSecretion signalPurificationPromoterExpression/inducerAdvantage
BaculoDirectSf9, Sf21, or High Five Cells-6xHisPolyhedrinInfectionFast and easy; ideal for high throughput
Bac-to-BacSf9, Sf21, or High Five CellsHoneybee melittin6xHisPolyhedrin or p10InfectionRapid production; easy blue/white selection
DESS2 cellsBIP6xHisMT or Ac5CuSO₄ or constitutiveClassic system for high-level production
  • Optimization considerations:

    • Multiplicity of infection (MOI): 5-10 is recommended

    • Expression time: 48-72 hours (longer times may cause aberrant processing)

    • Viral infection monitoring: Observable through 3 stages using phase microscopy

  • Post-translational modifications: Insect cells offer posttranslational modifications approaching that of mammalian cells, allowing production of recombinant protein that is more antigenically, immunogenically, and functionally similar to native protein than if expressed in yeast or other eukaryotes .

  • Scale-up potential: Insect cells offer ease of scale-up and simplified cell growth readily adaptable to high-density suspension culture for large-scale expression .

How can targeted overexpression strategies be applied to study amx-related pathways?

Strategic overexpression approaches provide insights into amx function:

  • Neuronal-specific expression: Restoring Amx expression specifically in neuronal cells using GAL4-UAS system rescues the reduced lifespan in amx null animals, demonstrating the importance of neuronal amx function .

  • Validation methods: Western blot analysis of amxΔ; 3xHA::amx brains confirms that 3xHA::Amx (predicted 35 kDa size) is expressed in the adult nervous system, validating the overexpression approach .

  • Functional domain analysis: Expression of Amx constructs containing only the highly conserved TM2 domain reveals that this domain alone can function as a potent inhibitor of Notch signaling, informing structure-function relationships .

  • Comparative rescue analysis: Different versions of amx or human TM2D3 can be expressed and compared for their ability to rescue various phenotypes:

    • Embryonic lethality (egg hatching assays)

    • Neurogenic phenotypes (Elav staining)

    • Adult lifespan

    • Electrophysiological responses

  • Application to recombinant protein production: Similar overexpression strategies using adapted Flux Scanning based on Enforced Objective Function (FSEOF) can predict overexpression targets for increasing recombinant protein production in other systems .

How do electrophysiological methods reveal age-dependent defects in amx mutants?

Electrophysiological recordings provide critical insights into age-dependent neurophysiological defects in amx mutants:

  • Giant fiber system recordings: This approach involves inserting stimulating electrodes into the brain and recording responses from the tergotrochanteral muscle (TTM) and dorsal longitudinal muscle (DLM) .

  • Age-dependent defects:

    • Young flies (5 days old): amxΔ mutants show TTM responses similar to controls, while DLM muscles have a small but significant decrease in response probability

    • Aged flies (25 days old): Both TTM and DLM responses in amxΔ mutants are significantly reduced

  • Rescue capabilities:

    • 3xHA::amx flies perform as well as controls

    • TM2D3 (human) partially rescues the phenotype, with 25-day-old amxΔ + human TM2D3 flies showing reduced DLM response compared to controls but improved compared to amxΔ alone

  • Quantification methods: Multiple unpaired t-tests with Holm-Šídák correction for multiple comparisons provide rigorous statistical analysis of response differences .

These findings suggest that amx function is particularly important for maintaining neuronal integrity during aging, potentially offering insights into the association between TM2D3 variants and age-related neurodegenerative diseases like Alzheimer's.

What CRISPR-based approaches are most effective for generating amx mutants?

Effective CRISPR-based approaches for generating amx mutants include:

  • Clean null allele generation: CRISPR can be used to generate precise deletions of the amx coding region (amxΔ), creating clean null alleles that behave like classic alleles (amx1) but with defined molecular lesions .

  • Allelic confirmation: The resulting amxΔ allele can be validated by:

    • Genomic PCR to confirm deletion

    • Phenotypic characterization (maternal-effect embryonic lethality)

    • Embryonic nervous system development analysis (Elav staining)

    • Egg hatching assays (~10% hatching rate in amxΔ compared to ~80% with rescue constructs)

  • Rescue construct design: To verify specificity, genomic rescue constructs should be created containing:

    • Wild-type amx gene with native regulatory elements

    • Epitope-tagged versions (3xHA::amx)

    • Human TM2D3 under control of fly amx regulatory elements

  • Multiple gene targeting: The CRISPR approach can be extended to generate double (amxΔ amrtΔ) and triple (amxΔ amrtΔ biscΔ) null mutants for all three TM2D family members, enabling assessment of functional redundancy .

How can the association between almondex and Notch cellular trafficking be experimentally demonstrated?

Researchers can demonstrate the association between almondex and Notch cellular trafficking through several experimental approaches:

  • Subcellular localization analysis:

    • Immunostaining for Notch receptors in wild-type vs. amx-deficient embryos

    • Focus on mid-stage 5 development in the neuroectoderm

    • Documentation of mesh-like accumulation patterns in mutants

  • Comparative analysis with other proteins:

    • Parallel staining for Delta ligand distribution

    • Verification that trafficking defects are specific to Notch rather than general vesicular trafficking

  • Surface expression quantification:

    • Analysis of cell surface expression of Notch1 and Notch2 in Tm2d3-deficient cells

    • Flow cytometry or surface biotinylation assays to quantify receptor levels

  • Physical association studies:

    • Co-immunoprecipitation to demonstrate TM2D3/amx physically associates with Notch1

    • Mapping of interaction regions to identify domains required for association

  • Functional validation:

    • Analysis of endocytosis of NECD and Delta ligand in amx-deficient embryos

    • Assessment of downstream Notch signaling outputs (e.g., target gene expression)

These approaches collectively provide compelling evidence for almondex's role in regulating Notch receptor trafficking and surface presentation.

What comparative genomics approaches can identify conserved functional domains in amx?

Effective comparative genomics approaches for identifying conserved functional domains in amx include:

  • Multiple sequence alignment:

    • Align amx protein sequences across diverse species (Drosophila, mammals, other invertebrates)

    • Identify highly conserved regions, particularly the TM2 domain and signal sequence

  • Domain architecture analysis:

    • Characterize the N-terminal signal peptide

    • Map the two potential transmembrane domains at the C-terminal region

    • Identify any additional conserved motifs

  • Functional conservation testing:

    • Express human TM2D3 under fly amx regulatory elements

    • Test for phenotypic rescue of amx mutants

    • Compare wild-type vs. disease-associated variants (e.g., P155L)

  • Evolutionary rate analysis:

    • Calculate evolutionary rates across different protein regions

    • Identify domains under purifying selection (highly conserved) vs. those evolving more rapidly

    • Correlate with known functional importance

  • Structure prediction:

    • Use the predicted 2D-structure of Drosophila Amx protein to identify key features

    • Compare with structural predictions for mammalian homologs

    • Integrate with experimental data on protein function

How can amx mutant neurophysiological phenotypes be systematically characterized?

Systematic characterization of amx mutant neurophysiological phenotypes requires a multi-faceted approach:

  • Giant fiber system electrophysiology:

    • Insert stimulating electrodes into the brain

    • Record responses from TTM and DLM muscles

    • Compare response probabilities across genotypes and ages

  • Age-dependent analysis:

    • Test flies at multiple age points (e.g., 5 days and 25 days)

    • Quantify progressive deterioration of responses

    • Compare with age-matched controls

  • Rescue experiments:

    • Express wild-type amx, epitope-tagged constructs, or human TM2D3

    • Determine if neurophysiological defects are rescued

    • Identify critical domains through truncation or point mutation analysis

  • Statistical analysis:

    • Apply multiple unpaired t-tests with appropriate correction for multiple comparisons

    • Calculate statistical significance of differences

    • Represent data with error bars showing standard error of the mean

  • Correlation with behavioral and lifespan data:

    • Integrate electrophysiological findings with lifespan data

    • Associate specific circuit defects with behavioral abnormalities

    • Establish temporal progression of phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.