Recombinant Drosophila melanogaster TM2 domain-containing protein CG11103 (CG11103)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type; we will prioritize its incorporation if possible.
Synonyms
CG11103; TM2 domain-containing protein CG11103
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-224
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG11103
Target Protein Sequence
QAIQARSDKEQPQTVVSGTAVQSVVPVQAQLGSGMGPSSSSSSASSASGGAGNSAFYPLG PNVMCSFLPRDFLDCKDPVDHRENATAQQEKKYGCLKFGGSTYEEVEHAMVWCTVFADIE CYGNRTFLRAGVPCVRYTDHYFVTTLIYSMLLGFLGMDRFCLGQTGTAVGKLLTMGGVGV WWIIDVILLITNNLLPEDGSNWNPYV
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG11103

UniGene: Dm.19151

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the TM2 domain-containing protein CG11103 in Drosophila melanogaster?

CG11103 (Amaretto) is one of three TM2 domain-containing proteins in Drosophila melanogaster. The protein features a predicted N-terminal signal sequence and two transmembrane domains that are connected through a short intracellular loop. Within this loop is an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, which is also found in some G-protein coupled receptors where it mediates conformational changes upon ligand binding. The extracellular region between the signal sequence and first transmembrane domain is more divergent compared to other TM2D proteins, while the sequences of the two transmembrane domains and the intracellular loop are highly conserved throughout evolution .

The protein also possesses a short C-terminal extracellular tail that is evolutionarily conserved but varies slightly among the three TM2D proteins in Drosophila. Specifically, CG11103 has structural similarities to its human ortholog TM2D2, maintaining the core functional domains that characterize this protein family .

How is CG11103 related to other TM2D proteins in Drosophila and humans?

CG11103 (Amaretto) is the Drosophila ortholog of human TM2D2. It belongs to a family of three TM2 domain-containing proteins in Drosophila, which also includes Almondex (Amx, ortholog of human TM2D3) and Biscotti (Bisc/CG10795, ortholog of human TM2D1). All three TM2D proteins are highly conserved across metazoans, with each species typically encoding three separate genes in this family .

The high degree of conservation in key structural elements, particularly the two transmembrane domains and the connecting intracellular loop containing the DRF motif, suggests functional importance maintained throughout evolution. High-throughput proteomics data from human cells has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, indicating these proteins may form a protein complex .

What phenotypes are observed in CG11103 null mutants?

Importantly, the neurogenic phenotypes observed in CG11103 mutants can be rescued by a 1.5 kb genomic construct containing the CG11103 locus, confirming that these phenotypes are specifically due to the loss of CG11103 function. Given the phenotypic similarities to almondex mutants, CG11103 was named amaretto (amrt), and the knockout allele is referred to as amrt^Δ .

What are effective methods for generating CG11103 knockout flies?

CRISPR/Cas9-mediated homology-directed repair (HDR) has been successfully used to generate null alleles of CG11103. The specific strategy employed in existing research involved inserting a dominant body color marker (y+) into the endogenous locus of CG11103 to knock out the gene. This approach facilitates easy phenotypic identification of mutant flies through the body color marker while creating a functional null allele .

The effectiveness of gene knockout should be validated through both phenotypic and molecular characterization. Molecularly, verification may include genomic PCR to confirm insertion, RNA analysis to verify absence of transcript, and protein analysis to confirm protein knockout. Phenotypically, validation involves assessing known phenotypes such as female sterility and maternal-effect neurogenic defects in embryos from mutant mothers .

How can researchers study the interactions between CG11103 and other TM2D proteins?

To investigate potential interactions between CG11103 (Amaretto) and other TM2D proteins (Almondex and Biscotti), researchers can employ several complementary approaches:

  • Genetic interaction studies: Generate double and triple knockout flies to assess whether phenotypes are enhanced or suppressed compared to single mutants. Current evidence suggests that triple null animals are not phenotypically worse than single nulls, indicating these genes function together in a non-redundant manner .

  • Biochemical approaches: Co-immunoprecipitation followed by mass spectrometry (co-IP/MS) can be used to detect physical interactions between TM2D proteins. This approach has already detected interactions between TM2D1-TM2D3 and TM2D2-TM2D3 in human cells .

  • Rescue experiments: Test whether overexpression of one TM2D protein can rescue phenotypes caused by mutations in another, which would suggest functional redundancy or cooperativity.

  • Subcellular co-localization: Use fluorescently tagged proteins to determine whether CG11103 co-localizes with other TM2D proteins in the same cellular compartments.

What protocols are recommended for expression and purification of recombinant CG11103 protein?

For recombinant expression and purification of CG11103, researchers can consider the following methodological approach:

  • Expression system selection: Due to CG11103 being a transmembrane protein, expression systems that facilitate proper membrane protein folding are recommended. Insect cell expression systems (such as Sf9 or High Five) are often suitable for Drosophila proteins, particularly those with transmembrane domains.

  • Construct design: Include affinity tags (His, FLAG, or GST) for purification, preferably at positions that don't interfere with protein folding or function. Consider expressing only the soluble domains for easier purification if the complete transmembrane protein proves challenging.

  • Solubilization and purification: For the full-length protein, use appropriate detergents for solubilization from membranes. For purification, employ affinity chromatography followed by size exclusion chromatography to ensure purity.

  • Validation: Confirm protein identity by Western blotting and mass spectrometry; assess proper folding through circular dichroism or thermal shift assays.

  • Activity assays: Develop functional assays based on its known role in Notch signaling, particularly at the γ-secretase cleavage step .

What is the role of CG11103 in Notch signaling pathways?

CG11103 (Amaretto) plays a critical role in embryonic Notch signaling in Drosophila. Research findings suggest that it functions at the γ-secretase cleavage step of the Notch signaling pathway. Overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling specifically at this step, suggesting that CG11103 and other TM2D proteins may regulate γ-secretase activity or access to its substrates .

The maternal-effect neurogenic phenotype observed in CG11103 null mutants is a characteristic hallmark of defective Notch signaling during embryonic development. Specifically, when Notch signaling is compromised, there is excessive neuroblast formation at the expense of epidermal cells, leading to the neurogenic phenotype. The functional requirement for CG11103 in multiple Notch-dependent processes during embryogenesis highlights its importance in this signaling pathway .

How do the three TM2D proteins in Drosophila function together in neurogenic development?

Evidence suggests that the three TM2D proteins in Drosophila (Almondex/TM2D3, Amaretto/CG11103/TM2D2, and Biscotti/CG10795/TM2D1) function together in embryonic neurogenesis rather than having redundant or independent functions:

  • Similar phenotypes: Single knockouts of each gene produce identical maternal-effect neurogenic phenotypes, indicating they affect the same developmental process .

  • No additive effects: Triple knockout animals do not exhibit phenotypes worse than single knockouts, suggesting these proteins function in the same pathway or complex rather than having additive or synergistic roles .

  • Protein interactions: Proteomics data from human cells indicates physical interactions between TM2D proteins, supporting the hypothesis that they form a functional complex .

  • Shared molecular function: All three proteins appear to modulate Notch signaling at the γ-secretase cleavage step, further supporting a shared functional role .

This evidence collectively suggests that the three TM2D proteins work together, possibly as a complex, to regulate Notch signaling during embryonic neurogenesis. Their coordinated action appears necessary for proper neural development, with no single protein able to compensate for the loss of another despite their structural similarities.

What is the significance of the DRF motif in CG11103 function?

The DRF (aspartate-arginine-phenylalanine) motif is an evolutionarily conserved sequence found in the intracellular loop connecting the two transmembrane domains of CG11103 and other TM2D proteins. This motif is also found in some G-protein coupled receptors, where it mediates conformational changes upon ligand binding .

The high conservation of this motif across species and among all three TM2D proteins suggests functional importance. In the context of G-protein coupled receptors, the DRF motif is involved in signal transduction, suggesting that in CG11103 it may similarly play a role in transmitting signals across the membrane or mediating protein-protein interactions essential for Notch signaling modulation .

While specific mutations targeting just the DRF motif have not been explicitly described in the available research, the conservation of this sequence makes it a promising target for future site-directed mutagenesis studies to directly assess its functional significance in Notch signal transduction and potential protein complex formation with other TM2D proteins.

How does research on CG11103 inform our understanding of human TM2D2 and potential disease associations?

Research on CG11103 (Amaretto) in Drosophila provides valuable insights into the potential functions of its human ortholog TM2D2, particularly in the context of neurological disorders:

  • Conservation of function: The shared phenotypes among TM2D gene knockouts in Drosophila suggest functional conservation. If this extends to humans, TM2D2 may work together with TM2D1 and TM2D3 in human neural development and function .

  • Alzheimer's disease connection: Rare variants in TM2D3 (human ortholog of Almondex) are associated with Alzheimer's disease (AD). Given the functional connection between all three TM2D genes in Drosophila, this suggests that the entire TM2D gene family, including TM2D2, may be involved in AD pathogenesis .

  • Notch signaling role: The involvement of CG11103 in Notch signaling in Drosophila suggests that human TM2D2 may similarly affect Notch processing, which is known to be dysregulated in various neurodegenerative conditions .

  • Phagocytosis connection: In a human cell-based CRISPR screen, all three human TM2D genes were identified as regulators of phagocytosis. Phagocytic dysfunction is implicated in various neurodegenerative disorders, suggesting another potential disease-relevant mechanism .

What are the molecular mechanisms underlying the maternal-effect neurogenic phenotype in CG11103 mutants?

The maternal-effect neurogenic phenotype observed in CG11103 mutants likely results from disrupted Notch signaling during embryonic development, though the precise molecular mechanisms require further investigation. Based on available research, several mechanisms can be proposed:

  • Disrupted γ-secretase processing: CG11103 appears to function at the γ-secretase cleavage step of Notch processing. Maternal contribution of CG11103 may be essential for proper γ-secretase activity during early embryogenesis .

  • Failed lateral inhibition: Notch signaling mediates lateral inhibition during neuroblast specification. Without proper Notch signaling due to CG11103 deficiency, this process fails, leading to excessive neuroblast formation at the expense of epidermal cells .

  • Protein complex disruption: Given that all three TM2D proteins likely function together, loss of CG11103 may disrupt a protein complex required for proper Notch signaling regulation .

  • Mesoectoderm specification: Recent research has shown that Almondex is required for Notch-dependent inductive signaling to specify the mesoectoderm during embryogenesis. Given the similar phenotypes, CG11103 may play a comparable role in this process .

How might the three TM2D proteins form a functional complex, and what techniques could elucidate this interaction?

Based on genetic and proteomics evidence suggesting TM2D proteins function as a complex, researchers could employ the following techniques to elucidate these interactions:

  • Cross-linking coupled with mass spectrometry (XL-MS): This technique can identify specific interaction sites between proteins in a complex, providing structural details about how TM2D proteins associate.

  • Förster resonance energy transfer (FRET): By tagging different TM2D proteins with appropriate fluorophores, FRET can detect close physical interactions between proteins in living cells, confirming complex formation in vivo.

  • Bimolecular fluorescence complementation (BiFC): This approach can visualize protein interactions in living cells by splitting a fluorescent protein between potential interaction partners, with fluorescence occurring only when the proteins interact.

  • Co-immunoprecipitation with deletion mutants: By creating deletion mutants lacking specific domains of TM2D proteins, researchers can identify which regions are essential for complex formation.

  • Cryo-electron microscopy: For structural characterization of the purified TM2D protein complex, revealing how these proteins arrange themselves spatially.

The functional significance of such a complex could then be validated through targeted disruption of specific interaction interfaces followed by phenotypic analysis in Drosophila models.

How do mouse knockout models of TM2D genes compare to Drosophila mutants?

Preliminary data from the International Mouse Phenotyping Consortium indicates that single knockouts of Tm2d1, Tm2d2, and Tm2d3 in mice are all recessive embryonic lethal prior to E18.5. This differs somewhat from Drosophila, where single TM2D gene knockouts result in viable adults but maternal-effect embryonic lethality .

This distinction suggests potential differences in the developmental timing or context of TM2D protein function between flies and mammals. In flies, maternal contribution of TM2D proteins can support embryonic development in zygotic mutants, whereas in mice, embryonic expression appears essential for survival to term .

Despite these differences, the shared embryonic lethality in both systems suggests that TM2D proteins have essential functions during embryogenesis across species. The severity of mouse phenotypes further underscores the developmental importance of these genes and suggests they may function together in essential developmental processes, similar to their role in Drosophila .

What methodological approaches can be used to investigate whether human TM2D2 can functionally replace CG11103 in Drosophila?

To test functional conservation between human TM2D2 and Drosophila CG11103, researchers could employ the following cross-species rescue approach:

  • Transgenic construct design: Create transgenic Drosophila lines expressing human TM2D2 under control of either:

    • The native CG11103 promoter to maintain endogenous expression patterns

    • A UAS promoter for targeted expression using the GAL4-UAS system

    • A heat shock promoter for temporal control of expression

  • Rescue experiment design: Introduce the human TM2D2 transgene into a CG11103 null background and assess rescue of phenotypes:

    • Female fertility restoration

    • Prevention of neurogenic phenotypes in embryos from mutant mothers

    • Restoration of normal Notch signaling patterns

  • Domain swap experiments: Create chimeric proteins containing domains from both human TM2D2 and Drosophila CG11103 to identify which regions confer functional specificity.

  • Interaction assessment: Test whether human TM2D2 can physically interact with Drosophila Almondex and Biscotti using co-immunoprecipitation or proximity ligation assays.

This approach would determine whether the molecular function of TM2D2 has been conserved through evolution and would provide insights into which domains or residues are critical for function across species.

What are promising future directions for CG11103 research in neurodegenerative disease models?

Given the association of TM2D3 variants with Alzheimer's disease and the functional connection between all three TM2D proteins, several promising research directions emerge:

  • Aging studies in Drosophila: Investigate whether CG11103 mutants show progressive neural dysfunction with age, similar to the shortened lifespan and progressive electrophysiological defects observed in Almondex mutants .

  • Disease model interactions: Test genetic interactions between CG11103 and established Drosophila models of neurodegenerative diseases, particularly those involving Notch signaling dysregulation or altered proteostasis.

  • Genetic screens: Conduct modifier screens to identify enhancers or suppressors of CG11103-associated phenotypes, potentially uncovering new therapeutic targets.

  • Phagocytosis studies: Investigate the role of CG11103 in glial cell phagocytosis of neuronal debris, given the identification of TM2D genes as regulators of phagocytosis in mammalian cells .

  • Human variant modeling: Introduce human TM2D2 variants identified in neurodegenerative disease patients into Drosophila to assess their functional impact in vivo.

These approaches could illuminate the mechanisms connecting TM2D protein function to neurodegeneration and potentially identify novel therapeutic strategies for conditions like Alzheimer's disease.

How can high-throughput screening approaches be optimized to identify modulators of CG11103 function?

To develop effective high-throughput screens for modulators of CG11103 function, researchers could consider these methodological approaches:

  • Reporter-based assays: Design Notch signaling reporter systems in Drosophila S2 cells or transgenic flies where GFP or luciferase expression indicates pathway activity. These could be used to screen for compounds or genetic factors that modify CG11103-dependent Notch signaling.

  • CRISPR activation/inhibition screens: Employ CRISPRa/CRISPRi libraries to systematically up- or down-regulate genes in Drosophila cell lines expressing CG11103, identifying genetic interactions that enhance or suppress phenotypes.

  • Phenotypic screens based on neurogenesis: Develop assays monitoring neurogenic phenotypes in Drosophila embryos from CG11103 heterozygous mothers, which may show sensitized phenotypes amenable to modification by small molecules.

  • Protein-protein interaction screens: Use split-reporter systems (like yeast two-hybrid or split-luciferase) to screen for compounds that modulate interactions between CG11103 and other TM2D proteins or components of the Notch pathway.

  • γ-secretase activity assays: Since CG11103 appears to function at the γ-secretase cleavage step, develop assays specifically monitoring this proteolytic event to screen for modulators.

Optimization strategies should include careful validation of hit compounds or genes in secondary assays and ultimate testing in whole-organism Drosophila models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.