Recombinant Drosophila melanogaster Transmembrane GTPase fzo (fzo)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fzo; CG4568; Transmembrane GTPase fzo; Protein fuzzy onions
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
fzo
Target Protein Sequence
MAESDSGESTSSVSSFISSSSSSRLSEFVDAKTELQDIYHDLSNYLSNFLTILEETVLLK DRQMLEHLCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTT SCFCQVQANGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSI LDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSR PNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALE ALHIRNGQITNPSGQTQQRYQEFLRFENDFSNCLAVSALKTKFGPHLLSAQKILNQLKST LICPFIEKVSRLIDENKERRANLNAEIEDWLILMQEDREALQYCFEELTEMTQRVGRCVL NDQIKTLIPSSVLSFSQPFHPEFPAQIGQYQRSLCAHLDKLLEDRVLQCLSIPLQRKILD IEKEIGLPIAENSCDWQLIYGLDCQSYMSDFQPDLRFRFSLGFTALWHRLEGNLPLHASP FRIQKLQNGHKKCSPLPPLVNGNHWQMLESLVKSKGSLGTVLLSAMAIRSFNWPIVLILG GLVGSFYIYEYAAWTTAAQERSFKSQYARLLQQRLRSDVQQTVSGFELQLRQHLATVRNC WEAQSNETLNDLNVRTAELTKQIQSMEVLQLSLKKFRDKGQLLASRLGDFQETYLTKS
Uniprot No.

Target Background

Function
fzo is an essential transmembrane GTPase mediating mitochondrial fusion during spermatogenesis. In early spermatocytes, mitochondrial fusion forms two organelles, the Nebenkern, a crucial step in regulating mitochondrial morphology through a balance between fusion and fission. fzo is essential for male fertility.
Gene References Into Functions
  1. fzo expression is limited to the male germline, with mRNA accumulation observed in spermatocytes and early spermatids. PMID: 12128227
Database Links

KEGG: dme:Dmel_CG4568

STRING: 7227.FBpp0083791

UniGene: Dm.33413

Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in male germ cells, in spermatocytes and early spermatids. Not expressed in other tissues.

Q&A

What is the functional significance of the fzo gene in Drosophila melanogaster?

The fuzzy onions (fzo) gene in Drosophila melanogaster encodes a large, novel transmembrane GTPase that functions as the first identified protein mediator of mitochondrial fusion. During Drosophila spermatogenesis, mitochondria in early postmeiotic spermatids undergo aggregation, fusion, and elongation alongside the growing flagellar axoneme. Males with mutations in the fzo gene exhibit defective mitochondrial fusion and consequently become sterile, demonstrating the critical role of this protein in developmental processes . The Fzo protein becomes detectable on spermatid mitochondria specifically during late meiosis II, just before fusion occurs, and notably disappears shortly after the fusion process is complete, indicating tight temporal regulation of its expression .

Methodologically, when investigating fzo function, researchers should consider employing fluorescent protein tagging combined with time-lapse microscopy to observe the dynamic localization patterns of Fzo during spermatogenesis. This approach allows for precise tracking of when and where the protein appears and disappears in relation to mitochondrial fusion events.

How is fzo protein expression regulated during Drosophila development?

The expression of the fzo protein exhibits strict developmental regulation, particularly in the context of spermatogenesis. The protein becomes detectable specifically on spermatid mitochondria during late meiosis II, precisely when the mitochondria are preparing to undergo fusion. Following the completion of mitochondrial fusion, the protein rapidly disappears from the mitochondrial membrane . This temporal regulation suggests the existence of sophisticated transcriptional and/or post-translational control mechanisms that govern Fzo activity.

For researchers investigating this regulation, combining techniques such as RNA-seq at different developmental stages with western blotting and immunofluorescence microscopy can provide comprehensive insights into both transcriptional and translational regulation patterns. Additionally, proteasome inhibitors can be employed to determine whether the rapid disappearance of Fzo after fusion involves proteasomal degradation.

What structural features characterize the Fzo transmembrane GTPase?

The Fzo protein is characterized as a large transmembrane GTPase with several conserved domains crucial for its function. The protein contains regions essential for GTP binding and hydrolysis, which are critical for its fusogenic activity . Missense mutations that alter conserved residues required for GTP binding inhibit the fusogenic activity of Fzo in vivo but interestingly do not affect its localization to mitochondria . This suggests that while GTPase activity is essential for fusion, it is not required for proper targeting of the protein to the mitochondrial membrane.

When studying the structure-function relationship of Fzo, researchers should consider employing site-directed mutagenesis targeting key residues in the GTPase domain, followed by complementation assays in fzo mutant flies to assess functional rescue. Combining these approaches with biochemical assays measuring GTPase activity can provide valuable insights into how specific structural elements contribute to Fzo function.

What experimental approaches are most effective for studying GTPase activity of recombinant Fzo protein?

When investigating the GTPase activity of recombinant Fzo protein, researchers should implement a multi-faceted experimental approach. Purification of the recombinant protein can be challenging due to its transmembrane nature, but expression systems utilizing insect cells often provide better results than bacterial systems for membrane proteins.

For GTPase activity assays, researchers can measure GTP hydrolysis rates using methods such as malachite green assays or HPLC-based quantification of GDP production. Comparative analysis with mammalian mitofusins can be valuable, as studies have shown that Mfn1 exhibits approximately eightfold higher GTPase activity than Mfn2 . This suggests potential mechanistic differences that may also apply to Drosophila Fzo.

A systematic approach to studying Fzo GTPase activity should include:

  • Expression and purification of wild-type and mutant Fzo proteins with alterations in conserved GTPase domain residues

  • In vitro GTPase activity assays comparing hydrolysis rates

  • Correlation of in vitro activity with in vivo fusion capability using complementation assays in fzo mutant flies

  • Assessment of protein-protein interactions using co-immunoprecipitation or yeast two-hybrid assays

These approaches together provide a comprehensive understanding of how GTPase activity contributes to the fusion capability of Fzo.

How can researchers design experiments to study the membrane tethering mechanism of Fzo?

Designing experiments to study the membrane tethering mechanism of Fzo requires sophisticated in vitro and in vivo approaches. Based on studies of mammalian mitofusins, which are homologs of Drosophila Fzo, researchers can adapt several proven methodologies .

For in vitro tethering assays, one effective approach involves:

  • Isolating mitochondria from cells expressing fluorescently tagged Fzo proteins (e.g., GFP-Fzo or RFP-Fzo)

  • Mixing these differently labeled mitochondrial populations in the presence or absence of GTP

  • Quantifying tethering events using fluorescence microscopy to detect co-localization

  • Performing complementary biochemical assays using immunoprecipitation of differentially tagged Fzo proteins to confirm trans-interactions

Studies with mammalian mitofusins have demonstrated that Mfn1-harboring mitochondria tether efficiently in a GTP-dependent manner, whereas Mfn2-containing mitochondria display significantly lower tethering efficiency . This suggests that exploring the tethering efficiency of Fzo in comparison to its mammalian counterparts could yield valuable insights into conserved and divergent mechanisms.

Additionally, sucrose density gradient centrifugation followed by co-immunoprecipitation can be employed to characterize oligomeric complexes formed during membrane tethering. In mammalian systems, Mfn1 forms ~250 kDa "cis" complexes on the same membrane and ~450 kDa "docking" complexes between apposing membranes . Determining whether Drosophila Fzo forms similar complexes would provide crucial mechanistic insights.

What methodologies are most effective for analyzing fzo mutant phenotypes in Drosophila?

The analysis of fzo mutant phenotypes requires a comprehensive approach combining genetic, cellular, biochemical, and developmental assessments. Since fzo mutant males exhibit sterility due to defects in mitochondrial fusion during spermatogenesis , a systematic analysis should include:

Genetic Approaches:

  • Generation of allelic series using CRISPR/Cas9 genome editing or traditional mutagenesis

  • Complementation tests with transgenic constructs expressing wild-type or mutant Fzo proteins

  • Creation of tissue-specific knockdowns using RNAi to assess function in different cell types

Cellular and Ultrastructural Analysis:

  • Electron microscopy to characterize mitochondrial morphology defects in mutant spermatids

  • Live-cell imaging using mitochondrial markers combined with fluorescently tagged Fzo

  • Super-resolution microscopy to visualize detailed structural changes during fusion attempts

Biochemical Assessments:

  • Analysis of GTP binding and hydrolysis in mutant proteins

  • Co-immunoprecipitation studies to identify altered protein interactions in mutant backgrounds

  • Blue-native PAGE to analyze complex formation similar to the studies performed with mammalian mitofusins

Developmental Progression Analysis:

  • Detailed characterization of spermatogenesis stages in fzo mutants

  • Assessment of axoneme development and mitochondrial elongation

  • Evaluation of sperm motility and structure in escapers or hypomorphic alleles

These methodologies collectively provide a comprehensive understanding of the functional defects in fzo mutants and can be used to precisely characterize the effects of specific mutations on distinct aspects of Fzo function.

How does Fzo compare functionally with its homologs in other species?

Comparative analysis of Fzo with its homologs across species reveals important evolutionary conservation and functional divergence of mitochondrial fusion mechanisms. Drosophila Fzo is known to have homologs in mammals (Mfn1 and Mfn2), nematodes, and yeast , suggesting deep evolutionary conservation of this mitochondrial fusion machinery.

Comparative Functional Analysis:

SpeciesHomolog(s)Expression PatternKey Functional DifferencesGTPase ActivityReference
DrosophilaFzoPrimarily testesEssential for spermatid developmentRequired for fusion
DrosophiladMFN (MARF)UbiquitousBroader role in various tissuesNot fully characterized
MammalsMfn1WidespreadMajor role in tethering, ~8× higher GTPase activityHigher
MammalsMfn2WidespreadLess efficient tethering than Mfn1Lower
PlantsFZLChloroplastsRegulates thylakoid organization, not mitochondrial morphologyRequired for function

For researchers conducting comparative studies, it is crucial to consider these functional differences when designing complementation experiments or when using heterologous expression systems to study conserved mechanisms.

What role does Fzo play in mitochondrial quality control mechanisms?

The role of Fzo in mitochondrial quality control represents an advanced area of investigation with significant implications for cellular homeostasis. While initial studies characterized Fzo primarily for its role in developmental mitochondrial fusion during spermatogenesis , the broader implications for mitochondrial quality control merit further investigation.

In Drosophila, the interaction between cell death pathways and mitochondrial dynamics provides important insights. Research has shown that Drosophila Reaper can induce mitochondrial fragmentation by binding to and inhibiting pro-fusion proteins like MFN2 and its Drosophila homologs . This suggests a potential regulatory mechanism where apoptotic factors may modulate mitochondrial fusion as part of cellular quality control.

Methodologically, researchers investigating Fzo's role in quality control should consider:

  • Genetic interaction studies between fzo and known mitochondrial quality control genes

  • Live-cell imaging approaches to track mitochondrial fusion/fission dynamics in response to various stressors

  • Biochemical analyses to identify post-translational modifications of Fzo under stress conditions

  • Proteomics approaches to identify stress-specific interaction partners

Additionally, researchers should design experiments to assess whether Fzo participates in mitophagy, the selective autophagic removal of damaged mitochondria, which represents a critical quality control mechanism in eukaryotic cells.

What are the key variables to consider when designing experiments with recombinant Fzo protein?

When designing experiments with recombinant Drosophila Fzo protein, researchers must carefully consider various variables to ensure robust and reproducible results. Following experimental design principles , these variables can be categorized as:

Independent Variables:

  • Protein variants (wild-type vs. specific GTPase domain mutations)

  • GTP concentration and presence of non-hydrolyzable GTP analogs

  • Membrane composition in reconstitution experiments

  • Presence of potential interaction partners or cofactors

  • Temperature and pH conditions

Dependent Variables:

  • GTPase activity (measured as GTP hydrolysis rate)

  • Membrane tethering efficiency

  • Fusion competence in reconstituted systems

  • Oligomeric state (monomer, dimer, or higher-order complexes)

  • Subcellular localization in cellular assays

Control Variables:

  • Protein purity and concentration

  • Buffer composition and ionic strength

  • Incubation times

  • Detection method sensitivity and calibration

  • Expression system used for protein production

Particularly critical is controlling for the transmembrane nature of Fzo, which presents significant challenges for recombinant expression and purification. When expressing Fzo, researchers should consider:

  • Using eukaryotic expression systems (insect cells, yeast) rather than bacterial systems

  • Employing detergent screening to identify optimal solubilization conditions

  • Testing various fusion tags for improved stability and purification

  • Verifying protein folding through activity assays prior to experimental use

Additionally, researchers should implement proper randomization techniques and include appropriate positive and negative controls to minimize experimental bias and ensure result validity .

How can researchers troubleshoot expression and purification of recombinant Fzo protein?

Expression and purification of recombinant transmembrane proteins like Fzo present significant technical challenges. A systematic troubleshooting approach includes addressing several key aspects of the expression and purification workflow:

Expression System Selection:

  • Insect cell systems (Sf9, High Five) often provide superior expression of complex transmembrane proteins compared to bacterial systems

  • Consider testing multiple expression vectors with different promoters (polyhedrin, p10) to optimize expression levels

  • Evaluate whole protein versus domain-specific constructs, particularly if the full-length protein proves difficult to express

Solubilization Optimization:

  • Conduct a detergent screen including mild (DDM, LMNG) and harsh (SDS, Triton X-100) detergents

  • Test detergent combinations and assess protein stability using thermal shift assays

  • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for maintaining the protein in a more native-like environment

Purification Strategy:

  • Implement multi-step purification including affinity chromatography followed by size exclusion

  • Monitor protein quality at each step using both SDS-PAGE and functional assays

  • Consider on-column detergent exchange during purification to improve stability

Activity Preservation:

  • Test various buffer compositions, paying particular attention to salt concentration and pH

  • Include stabilizing agents such as glycerol or specific lipids that might be required for function

  • Minimize freeze-thaw cycles and optimize storage conditions through stability testing

Troubleshooting Decision Tree:

For low expression:

  • Adjust induction conditions (timing, temperature, inducer concentration)

  • Test different cell lines or expression systems

  • Optimize codon usage for the expression host

  • Consider fusion partners that enhance solubility (MBP, SUMO)

For poor solubility:

  • Screen additional detergents or lipid mixtures

  • Try extraction with different detergent-to-protein ratios

  • Consider co-expression with known interaction partners

  • Test truncated constructs removing non-essential domains

For loss of activity:

  • Verify protein folding using biophysical methods (CD spectroscopy, thermal shift)

  • Ensure the presence of required cofactors (lipids, nucleotides)

  • Test the addition of stabilizing agents during purification

  • Consider mild immobilization strategies to preserve structure

What analytical methods are most suitable for characterizing Fzo-mediated membrane interactions?

Characterizing Fzo-mediated membrane interactions requires sophisticated analytical methods that can capture both structural and dynamic aspects of these processes. Based on successful approaches with mammalian mitofusins , researchers should consider the following analytical methods:

Microscopy-Based Methods:

  • Fluorescence microscopy of labeled mitochondria to visualize tethering in vitro

  • FRET-based assays to detect close apposition of membranes mediated by Fzo

  • Super-resolution microscopy (STORM, PALM) to characterize Fzo distribution and clustering

  • Electron microscopy to visualize membrane contact sites at nanometer resolution

Biochemical and Biophysical Methods:

  • Co-immunoprecipitation of differentially tagged Fzo proteins to detect trans-interactions

  • Sucrose density gradient ultracentrifugation to characterize oligomeric complexes

  • Blue-native PAGE to analyze native complex formation, similar to the ~250 kDa and ~450 kDa complexes observed with Mfn1

  • Surface plasmon resonance or biolayer interferometry to measure binding kinetics

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

Functional Assays:

  • Liposome fusion assays using fluorescence dequenching to measure fusion efficiency

  • GTPase activity assays correlated with membrane tethering capacity

  • In vitro reconstitution with purified components to establish minimal requirements

Computational Methods:

  • Molecular dynamics simulations to model Fzo-membrane interactions

  • Protein-protein docking to predict oligomerization interfaces

  • Bioinformatic analysis comparing Fzo structural features across species

When analyzing Fzo-mediated membrane interactions, it is crucial to distinguish between tethering (bringing membranes into close proximity) and fusion (merging of membranes). These distinct steps may involve different domains of the protein and have different requirements for GTPase activity, as suggested by studies of mammalian mitofusins .

How should researchers interpret conflicting data on Fzo function?

When faced with conflicting data regarding Fzo function, researchers should implement a systematic approach to data analysis and interpretation:

Sources of Potential Conflicts:

  • Different experimental systems (in vitro vs. in vivo, different cell types)

  • Variations in protein constructs (full-length vs. truncated, tag position effects)

  • Species-specific differences when comparing Fzo to mammalian mitofusins

  • Technical variations in assay conditions or measurements

Resolution Strategies:

  • Direct Comparison Studies:
    Design experiments that directly compare conditions under which conflicting results were obtained, controlling for all variables except the one being tested.

  • Validation Across Multiple Techniques:
    Confirm observations using complementary methodologies. For instance, if microscopy and biochemical assays yield different results, investigate whether they are measuring different aspects of the same process.

  • Genetic Complementation Analysis:
    Test whether different Fzo variants can rescue the sterility phenotype in fzo mutant flies . This provides a clear functional readout in the native context.

  • Collaboration with Labs Reporting Conflicting Results:
    Direct collaboration can help identify unstated methodological differences that may account for discrepancies.

  • Meta-analysis Approach:
    Systematically compare methodologies and results across multiple studies to identify patterns that may explain variability.

When interpreting data on Fzo function, it is crucial to consider that different experimental conditions may reveal different aspects of Fzo biology. For example, the distinct activities observed between mammalian Mfn1 and Mfn2 in membrane tethering suggest that even closely related proteins can have specialized functions that might only be revealed under specific experimental conditions.

What statistical approaches are most appropriate for analyzing mitochondrial fusion dynamics?

Analyzing mitochondrial fusion dynamics requires sophisticated statistical approaches that can capture both the spatial and temporal aspects of these processes:

Quantitative Parameters for Fusion Analysis:

  • Fusion event frequency (events per mitochondrion per unit time)

  • Time from contact to complete fusion

  • Efficiency of fusion (percentage of contacts leading to fusion)

  • Changes in mitochondrial network morphology (length, branching, connectivity)

  • Distribution of Fzo protein on the mitochondrial surface

Appropriate Statistical Approaches:

  • Time Series Analysis:

    • Autocorrelation functions to identify temporal patterns in fusion events

    • Change-point detection to identify transitions in fusion behavior

    • Hidden Markov Models to identify distinct states in fusion dynamics

  • Spatial Statistics:

    • Ripley's K-function to analyze Fzo clustering on mitochondrial membranes

    • Moran's I or Geary's C to quantify spatial autocorrelation in protein distribution

    • Nearest neighbor analysis to characterize distribution patterns

  • Network Analysis:

    • Graph-based metrics to quantify mitochondrial network complexity

    • Centrality measures to identify key nodes in the mitochondrial network

    • Community detection to identify subpopulations of connected mitochondria

  • Machine Learning Approaches:

    • Supervised classification to automatically identify fusion events

    • Unsupervised clustering to identify distinct mitochondrial morphologies

    • Deep learning for tracking and analyzing complex dynamics in time-lapse data

For all statistical analyses, researchers should:

  • Determine appropriate sample sizes through power analysis

  • Apply corrections for multiple comparisons when necessary

  • Validate results across different experimental conditions

  • Consider biological variability in addition to technical variability

When analyzing perturbation experiments (e.g., GTPase mutations), appropriate statistical tests should be selected based on data distribution, with non-parametric alternatives employed when normality assumptions are violated.

What are the most promising future research directions for studying Fzo function?

The study of Drosophila Fzo presents several promising research directions that could significantly advance our understanding of mitochondrial dynamics and their role in development and disease:

Structural Biology:

  • Determination of the high-resolution structure of Fzo, particularly focusing on conformational changes during GTP binding and hydrolysis

  • Characterization of the membrane interaction domains and how they facilitate fusion

  • Structural comparison with mammalian mitofusins to identify conserved functional elements

Regulatory Mechanisms:

  • Identification of post-translational modifications that regulate Fzo activity during development

  • Characterization of the rapid degradation mechanism that removes Fzo after fusion completion

  • Investigation of transcriptional and translational control mechanisms that restrict Fzo expression to specific developmental contexts

Interaction Networks:

  • Comprehensive identification of Fzo-interacting proteins using proximity labeling approaches

  • Characterization of how Reaper-induced mitochondrial fragmentation relates to Fzo function

  • Investigation of potential functional interactions between Fzo and dMFN in different tissues

Comparative Biology:

  • Further investigation of why plants utilize FZO-like proteins (FZL) for thylakoid organization rather than mitochondrial fusion

  • Characterization of how mitochondrial fusion mechanisms differ between tissues that express primarily Fzo versus dMFN

  • Evolutionary analysis of the diversification of mitofusin-like proteins across eukaryotes

Technological Advances:

  • Development of optogenetic tools to control Fzo activity with spatial and temporal precision

  • Adaptation of super-resolution microscopy techniques to visualize Fzo-mediated tethering in vivo

  • Creation of biosensors to monitor GTPase activity in living cells

These research directions collectively promise to provide deeper insights into the fundamental mechanisms of mitochondrial fusion and how these processes are regulated during development. The restricted expression pattern of Fzo compared to the ubiquitous expression of dMFN suggests interesting tissue-specific adaptations of mitochondrial dynamics that warrant further investigation.

How might findings about Fzo contribute to understanding human mitochondrial diseases?

Research on Drosophila Fzo has significant translational potential for understanding human mitochondrial diseases, particularly those associated with defects in mitochondrial dynamics:

Translational Relevance:

  • Charcot-Marie-Tooth Type 2A (CMT2A):
    Mutations in human MFN2 (a homolog of Fzo) cause CMT2A, a peripheral neuropathy characterized by progressive muscle weakness and sensory loss. Insights from Fzo regarding GTPase-dependent fusion mechanisms could illuminate how specific mutations disrupt this process in humans.

  • Developmental Disorders:
    The essential role of Fzo in Drosophila spermatogenesis suggests that tissue-specific requirements for mitochondrial fusion may exist in humans. This could explain why mutations in ubiquitously expressed fusion proteins often affect specific tissues preferentially.

  • Neurodegenerative Diseases:
    Mitochondrial dynamics are increasingly implicated in conditions like Parkinson's and Alzheimer's disease. Understanding the basic mechanisms of Fzo-mediated fusion could provide insights into how these processes become dysregulated in neurodegeneration.

Research Translation Approaches:

  • Disease Model Development:

    • Creation of Drosophila models expressing Fzo variants analogous to disease-causing mutations in human MFN1/2

    • Comparative phenotypic analysis between fly models and patient-derived cells

    • High-throughput screening using Drosophila to identify potential therapeutic compounds

  • Mechanistic Insights:

    • Detailed characterization of how specific mutations affect different aspects of fusion (tethering versus membrane merger)

    • Investigation of tissue-specific requirements for mitochondrial fusion that might explain the selective vulnerability of certain tissues in human diseases

    • Analysis of potential compensatory mechanisms that might be therapeutically exploited

  • Therapeutic Target Identification:

    • Characterization of the regulatory pathways controlling Fzo expression and activity

    • Identification of proteins that modulate Fzo function as potential drug targets

    • Development of small molecules that could enhance the activity of partially functional mitofusin variants

The comparative study of mitofusins across species provides a powerful approach for identifying conserved mechanisms that are likely to be relevant to human disease. The distinct properties of Mfn1 and Mfn2 in mammals , along with the tissue-specific expression patterns of Fzo and dMFN in Drosophila , suggest a complex evolutionary history of functional specialization that may provide insights into the tissue-specific manifestations of human mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.