Recombinant Drosophila melanogaster Transmembrane protein 11 homolog, mitochondrial (Pmi)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila melanogaster Transmembrane Protein 11 Homolog, Mitochondrial (Pmi)

Recombinant Drosophila melanogaster Transmembrane protein 11 homolog, mitochondrial (Pmi), also known as Protein PMI, is a protein that, in Drosophila, is encoded by the PMI gene . The human ortholog of Pmi is TMEM11 . Pmi and TMEM11 are inner membrane proteins that regulate mitochondrial morphogenesis, independently of the DRP-1/MFN-1 pathways .

Basic Information

PropertyDescription
Recommended NameTransmembrane protein 11 homolog, mitochondrial
Alternative Name(s)Protein PMI
SourceYeast
SpeciesDrosophila melanogaster (Fruit fly)
Uniprot No.Q8IQ56
Purity>85% (SDS-PAGE)
Tag InfoDetermined during manufacturing
Protein LengthPartial
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
NotesStore working aliquots at 4°C for up to one week; repeated freezing and thawing is not recommended . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add 5-50% glycerol for long-term storage at -20°C/-80°C .

Function and Significance

Drosophila Pmi and its human ortholog TMEM11 are regulators of mitochondrial morphogenesis . Mitochondria are dynamic organelles that change in morphology during the cell cycle, development, or in response to extracellular stimuli . These morphological dynamics are controlled by a balance between fusion and fission pathways .

Key findings regarding the function and significance of Pmi/TMEM11:

  • Regulation of Mitochondrial Shape: PMI is involved in shaping the mitochondrial network in Drosophila. PMI-mutant cells have a condensed mitochondrial network, suggesting that PMI may have a pro-fission or anti-fusion function . TMEM11 regulates mitochondrial shape in human cells. Reduction of TMEM11 levels results in a condensation of the mitochondrial network with a loss of tubular shape .

  • Independence from DRP1/MFN Pathways: PMI shapes mitochondria through a mechanism independent of drp1 and mfn, indicating that mitochondrial networks can be shaped by separate pathways: one PMI-dependent and one DRP1/MFN-dependent .

  • Inner-membrane Localization: Both Drosophila PMI and human TMEM11 are located in the inner mitochondrial membrane . Electron microscopy and proteolysis assays confirmed the inner-membrane localization of PMI and TMEM11 .

  • Interaction with Other Proteins: In mammals, TMEM11 interacts with BNIP3, a Bcl2-like stress sensor that affects mitochondrial morphology and regulates mitophagy, cell death, or survival in response to hypoxia and infection . In Drosophila, Pmi is transcribed from a bi-cistronic locus that also encodes PGRP-LD, a microbial-recognition protein .

Role in Mitochondrial Dynamics

Mitochondrial dynamics involve continuous fission and fusion, essential for maintaining mitochondrial function and adapting to cellular needs .

  • TMEM11 regulates mitochondrial morphology in human cells: Reduction of TMEM11 levels leads to a condensation of the mitochondrial network and a loss of tubular shape .

  • TMEM11's effect on mitochondrial morphology differs from that of DRP1 and OPA1: DRP1 knockdown results in a less pronounced condensation of the mitochondrial network, while OPA1-depleted cells have smaller and more numerous spherical mitochondria, indicative of mitochondrial fragmentation .

Recombinant Protein Details

Recombinant Drosophila melanogaster Transmembrane protein 11 homolog, mitochondrial (Pmi) is available as a recombinant protein for research purposes .

  • It is produced in yeast .

  • The protein is available in both liquid and lyophilized forms .

  • It is recommended to reconstitute the protein in deionized sterile water and store it with glycerol at -20°C/-80°C for long-term storage .

Drosophila melanogaster as a Model System

Drosophila melanogaster serves as a valuable model organism in biological research, including the study of mitochondrial biology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
Pmi; CG33718; Transmembrane protein 11 homolog, mitochondrial; Protein PMI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Pmi
Target Protein Sequence
MVSRNIESTSKVPTFHVIREVYDSSNAHERFEAELDKALEAKLDFIVIEPPRLGDETGRW IWVGNCLHKTAVATGVVSLVASLLWRDRPIIAAPACALSIFCTGLYTVSWNYDPCCQYQV ENNDTVLEKLPLTDVSSPVILGYSPNSKTKYLHRSVSLLSAALCAWQIWRSYNRFVHSAG SG
Uniprot No.

Target Background

Function

Plays a role in mitochondrial morphogenesis.

Gene References Into Functions
  1. These data suggest that PMI influences mitochondrial diameter and tubular shape by controlling crista length. PMID: 23264743
  2. This study shows that the PMI gene and its human ortholog TMEM11 encode mitochondrial inner-membrane proteins that regulate mitochondrial morphogenesis. Epistatic experiments indicate that PMI shapes mitochondria through a mechanism independent of Drp1 and Mfn. PMID: 21274005
Database Links

KEGG: dme:Dmel_CG33718

STRING: 7227.FBpp0289218

UniGene: Dm.21293

Protein Families
TMEM11 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.