Recombinant Drosophila melanogaster Transmembrane protein 120 homolog (CG32795)

Shipped with Ice Packs
In Stock

Description

Introduction to CG32795

CG32795 (UniProt ID: Q9U1M2) is a transmembrane protein homolog in Drosophila melanogaster, identified by genomic studies. Its recombinant form is engineered for experimental use, with partial or full-length sequences expressed in various host systems. While its precise biological function remains uncharacterized, it is implicated in studies related to genetic variation and recombination rates .

Expression Systems and Tags

CG32795 is produced via recombinant protein technology in multiple host systems:

Host SystemTagSourcePurity
E. coliHis-tagCreative BioMart >90% (SDS-PAGE)
Mammalian cellsUndisclosedCusabio >85% (SDS-PAGE)
YeastAvi-tagCusabio >85% (SDS-PAGE)

The full-length protein (1–387 amino acids) includes a His-tag for purification , while partial sequences are also available .

Experimental Uses

CG32795 recombinant proteins are employed in:

  • Immunoassays:

    • ELISA: Detecting antibodies against CG32795 in serum or lysates .

    • Western Blot: Validating protein expression or purification efficiency .

  • Biochemical Studies:

    • Reconstitution: Proteins are reconstituted in deionized sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) for stability .

Genetic Context

CG32795 has been linked to studies on recombination rate variation in D. melanogaster. For example:

  • Genetic Association: Identified as one of 20 candidate genes in a genome-wide association study (GWAS) investigating natural variation in recombination rates .

  • Recombination Dynamics: While not directly implicated in recombination machinery, its genetic locus may influence chromosomal interactions .

Research Gaps and Future Directions

  • Functional Elucidation: No direct evidence links CG32795 to specific cellular processes (e.g., signaling, immunity).

  • Structural Analysis: Crystallization or cryo-EM studies are needed to resolve domain architecture.

  • Genetic Validation: Functional assays (e.g., RNAi knockdown) are required to confirm its role in recombination or other pathways .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
As a standard practice, all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. As a default, we include 50% glycerol in our final product. This concentration can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, it is essential to aliquot the protein. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CG32795; Transmembrane protein 120 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG32795
Target Protein Sequence
MNIDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLR QFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDK VRYKDDYEKFKLILNVIGLIMAFFNLIFNYRALELAFIFLLVWYYCTLTIRESILKVNGS RIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYR LKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHV SVMSGLFLLLFVGNMATTLWVVPEKIRERAKERYRLQSMGKSMKLRKEMKNSASDLDLSS GSKLSPTATTTTSIATATQTPAEKKET
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG32795

STRING: 7227.FBpp0301615

UniGene: Dm.12232

Protein Families
TMEM120 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CG32795 and what is its significance in Drosophila research?

CG32795 is a newly predicted gene in Drosophila melanogaster that encodes the transmembrane protein 120 homolog. Based on comparative genomics, it represents the Drosophila ortholog of mammalian TMEM-120A (also known as TACAN). The gene was initially identified during molecular characterization of mutations affecting the white gene, where an FB element (transposable element Foldback) was found to be inserted into the second intron of CG32795 .

The significance of CG32795 stems from its evolutionary conservation and potential functional roles. Based on studies of its orthologs in other organisms, particularly the tmem-120 gene in C. elegans, this protein likely plays important roles in reproductive physiology and may interact with mechanosensitive proteins .

How is CG32795 related to genes and proteins in other model organisms?

CG32795 shows significant homology to transmembrane protein 120 family members across species:

SpeciesGene/ProteinFunctional CharacterizationKey Phenotypes
Drosophila melanogasterCG32795Transmembrane protein 120 homologNot fully characterized
Caenorhabditis eleganstmem-120Regulates reproductive physiologyDeformed germline, maternal sterility, reduced brood size
MammalsTMEM-120A/TACANNegative regulator of PIEZO2, potential mechanically activated proteinNot described in search results

The evolutionary conservation of this protein family suggests important biological functions. In C. elegans, tmem-120 has been shown to interact genetically with pezo-1 (the C. elegans PIEZO ortholog) in regulating reproduction . These findings provide a foundation for hypothesizing similar roles for CG32795 in Drosophila.

What expression patterns have been observed for CG32795?

While detailed expression data specifically for CG32795 in Drosophila is limited in the available search results, expression patterns can be inferred from studies of its ortholog in C. elegans. The tmem-120 gene in C. elegans is expressed throughout development, with particularly high expression in the germline, embryos, and spermatheca .

For researchers studying CG32795 expression in Drosophila, the following methodological approaches are recommended:

  • Developmental RNA-seq analysis across embryonic, larval, pupal, and adult stages

  • Tissue-specific RT-PCR to identify expression in reproductive versus somatic tissues

  • In situ hybridization to visualize spatial expression patterns

  • Generation of reporter constructs using the CG32795 promoter

Based on the conservation between tmem-120 and CG32795, examination of reproductive tissues and developing embryos should be prioritized.

What molecular mechanisms underlie CG32795 function?

The molecular function of CG32795 can be inferred from studies of its orthologs. TMEM-120A has been characterized as both a potential mechanically activated molecule and a lipid-modifying enzyme . Additionally, it functions as a negative regulator of the mechanosensitive protein PIEZO2 .

To investigate the molecular mechanisms of CG32795, researchers should consider:

  • Structural analysis to identify conserved domains and potential binding sites

  • Biochemical assays to test potential enzymatic activities

  • Electrophysiological studies to assess mechanosensitive properties

  • Protein-protein interaction studies to identify binding partners

The epistatic interaction observed between tmem-120 and pezo-1 in C. elegans suggests that CG32795 may interact with and regulate Drosophila mechanosensitive channels, potentially through direct protein-protein interactions or by modifying the lipid environment in which these channels function.

How can CRISPR/Cas9 technology be optimized for CG32795 functional studies?

CRISPR/Cas9 offers powerful approaches for studying CG32795 function in Drosophila. Based on successful genetic manipulation strategies in C. elegans , researchers should consider the following methodological approach:

CRISPR/Cas9 StrategyApplicationMethodological Considerations
Complete gene deletionAssess null phenotypeMay cause lethality if developmentally essential
Conditional knockoutTissue-specific or temporal controlRequires careful design of conditional systems
Endogenous taggingVisualize protein localizationMinimize tag interference with protein function
Point mutationsStructure-function analysisTarget conserved residues identified through alignment
Auxin-inducible degradationTemporal control of protein levelsSuccessfully employed for tmem-120 in C. elegans

When designing guide RNAs, researchers should avoid targeting regions with potential off-target effects and consider the genomic context of CG32795. The FB element insertion site in the second intron identified in previous studies should be noted when designing targeting strategies.

What phenotypic assessments are most informative for CG32795 mutant analysis?

Based on phenotypes observed in C. elegans tmem-120 mutants, the following phenotypic analyses are recommended for CG32795 mutants in Drosophila:

  • Reproductive system development and function:

    • Gonad morphology and development

    • Gametogenesis assessment (oogenesis and spermatogenesis)

    • Fertility measurements (egg laying, hatching rates)

  • Embryonic development:

    • Early embryonic patterning and morphogenesis

    • Live imaging to detect abnormalities during morphogenetic movements

  • Cell mechanical properties:

    • Osmotic stress responses

    • Cell shape and cytoskeletal organization

    • Resistance to mechanical deformation

In C. elegans, tmem-120Δ mutants display deformed germline, maternal sterility, and reduced brood size . Live imaging revealed pinched zygotes in the uterus of mutant animals, suggesting damage during mechanical stress of spermathecal contraction . Similar assays in Drosophila would provide valuable comparative insights.

What strategies are effective for recombinant expression of CG32795 protein?

For successful recombinant expression of Drosophila melanogaster Transmembrane protein 120 homolog, researchers should consider the following methodological approaches:

Expression SystemAdvantagesLimitationsApplications
Bacterial (E. coli)High yield, low costLimited post-translational modificationsExpression of soluble domains
Insect cells (S2, Sf9)Native processing, proper foldingMore complex, moderate yieldFull-length protein expression
BaculovirusHigh yield of eukaryotic proteinTechnical complexityStructural studies
Cell-free systemsRapid expression, membrane proteinsLow yield, expensiveInitial screening

For transmembrane proteins like CG32795, specific considerations include:

  • Fusion tags selection:

    • N-terminal tags generally preferred for membrane proteins

    • Cleavable tags recommended for structural/functional studies

    • Consider dual tags (e.g., His-MBP) for improved solubility and purification

  • Solubilization strategies:

    • Detergent screening (starting with mild detergents like DDM, LMNG)

    • Nanodiscs for maintaining native-like membrane environment

    • GFP-fusion monitoring for assessing proper folding

  • Expression optimization:

    • Temperature reduction during induction (16-20°C)

    • Codon optimization for expression host

    • Addition of molecular chaperones

Commercial recombinant CG32795 is available , but researchers requiring specific constructs should optimize expression conditions empirically.

What imaging approaches best capture CG32795 localization and dynamics?

To effectively visualize CG32795 localization and dynamics, researchers should employ multi-modal imaging strategies:

  • Fixed-sample imaging:

    • Immunofluorescence with anti-CG32795 antibodies

    • Super-resolution microscopy (STED, PALM, STORM) for nanoscale organization

    • Correlative light and electron microscopy for ultrastructural context

  • Live-cell imaging:

    • Endogenous fluorescent protein tagging via CRISPR/Cas9

    • Spinning disk confocal for rapid acquisition with minimal phototoxicity

    • Photobleaching or photoactivation for protein dynamics

  • Sample preparation considerations:

    • Careful fixation protocols to preserve membrane protein localization

    • Permeabilization optimization to maintain membrane integrity

    • Appropriate blocking to minimize non-specific antibody binding

For developmental studies, researchers should consider live imaging approaches similar to those employed for C. elegans tmem-120 visualization, which successfully captured reproductive tract dynamics and identified pinched zygotes in tmem-120Δ mutants .

How can genetic interaction studies inform CG32795 function?

Genetic interaction studies provide crucial insights into functional relationships between genes. Based on the epistatic interaction observed between tmem-120 and pezo-1 in C. elegans , similar approaches in Drosophila would be informative:

  • Double mutant analysis:

    • Generate CG32795 mutations in combination with Drosophila mechanosensitive channel mutations

    • Assess phenotypic enhancement or suppression

    • Quantitatively measure interaction effects on fertility and development

  • Modifier screens:

    • Use sensitized CG32795 mutant backgrounds for forward genetic screens

    • Employ deficiency kits to rapidly identify genomic regions containing modifiers

    • Conduct RNAi screens in specific tissues for pathway identification

  • Experimental design considerations:

    • Include appropriate genetic background controls

    • Quantify phenotypes objectively using established metrics

    • Employ multiple alleles to confirm specificity of interactions

In C. elegans, loss of tmem-120 alleviated the brood size reduction and defective sperm navigation behavior in pezo-1Δ mutants . This suggests a negative regulatory relationship that may be conserved in Drosophila, providing a specific hypothesis to test.

How should researchers interpret contradictory phenotypic data from CG32795 studies?

When confronted with contradictory results in CG32795 studies, researchers should implement the following analytical framework:

  • Methodological reconciliation:

    • Examine differences in genetic backgrounds and experimental conditions

    • Consider tissue-specific or developmental stage-specific effects

    • Evaluate the sensitivity and specificity of different assays

  • Biological explanation assessment:

    • Consider redundancy with related genes

    • Evaluate potential context-dependent functions

    • Assess the possibility of threshold effects or compensatory mechanisms

  • Integration strategies:

    • Perform side-by-side comparisons with standardized protocols

    • Utilize multiple complementary approaches to test hypotheses

    • Conduct meta-analysis of available data with appropriate statistical methods

The potential roles of CG32795 in both reproductive development and mechanosensation suggest multiple functions that may manifest differently depending on experimental context, similar to the complex phenotypes observed with tmem-120 in C. elegans .

What evolutionary insights can be gained from comparative analysis of CG32795 orthologs?

Comparative analysis of TMEM-120 family proteins across species provides valuable evolutionary context:

Analytical ApproachMethodologyResearch Applications
Sequence conservation analysisMultiple sequence alignment, phylogenetic reconstructionIdentification of functional domains, evolutionary rate assessment
Functional complementationCross-species rescue experimentsTesting functional equivalence across evolutionary distance
Expression pattern comparisonComparative transcriptomicsIdentification of conserved regulatory mechanisms
Phenotypic comparisonSimilar assays across model organismsDetection of conserved versus divergent functions

How can multi-omics approaches enhance understanding of CG32795 function?

Integration of multiple omics technologies provides comprehensive insights into CG32795 function:

  • Transcriptomic approaches:

    • RNA-seq of CG32795 mutants to identify dysregulated genes

    • Single-cell RNA-seq to detect cell-type specific effects

    • TIME-seq for temporal dynamics during development

  • Proteomic methods:

    • Proximity labeling (BioID, APEX) to identify interaction partners

    • Phosphoproteomics to detect signaling changes

    • Quantitative proteomics to assess protein abundance changes

  • Metabolomic analysis:

    • Lipidomics to investigate potential lipid-modifying functions

    • Targeted metabolite analysis in reproductive tissues

    • Flux analysis to assess metabolic pathway alterations

  • Integration strategies:

    • Network analysis to identify key pathways

    • Multi-omics data visualization tools

    • Machine learning approaches for pattern recognition

The potential roles of CG32795 in lipid modification (based on TMEM-120A function) and reproductive physiology suggest that lipidomic analysis of reproductive tissues in mutants would be particularly informative.

What are the implications of CG32795 research for understanding human disease mechanisms?

Research on CG32795 has potential translational relevance for human health:

  • Mechanosensation and pain:

    • If CG32795 regulates mechanosensitive channels similar to TMEM-120A's regulation of PIEZO2

    • Potential implications for pain perception and mechanical hypersensitivity

    • Novel targets for analgesic development

  • Reproductive disorders:

    • Based on fertility defects in C. elegans tmem-120 mutants

    • Potential role in human infertility or reproductive disorders

    • Genetic screening in patients with unexplained reproductive issues

  • Developmental disorders:

    • If CG32795 functions in embryonic development

    • Potential role in congenital abnormalities

    • Candidate gene for developmental disorder genetic panels

While direct evidence linking CG32795 to human disease is currently limited, the evolutionary conservation of this protein family suggests important biological functions with potential disease relevance.

What technical innovations could advance CG32795 research?

Emerging technologies with potential to transform CG32795 research include:

  • Genome engineering advances:

    • Base editing for precise point mutations

    • Prime editing for complex genetic modifications

    • Tissue-specific CRISPR delivery methods

  • Imaging innovations:

    • Expansion microscopy for enhanced resolution

    • Adaptive optics for deep tissue imaging

    • Integrative correlative microscopy workflows

  • Single-cell technologies:

    • Spatial transcriptomics to map expression patterns

    • Single-cell proteomics for protein-level analysis

    • Spatial CRISPR screening for tissue-specific function

  • Structural biology approaches:

    • Cryo-EM for membrane protein structure determination

    • Integrative structural modeling combining multiple data types

    • In-cell structural analysis through advanced labeling techniques

Implementation of these technologies would address current limitations in understanding CG32795 function, particularly regarding its membrane organization, interaction partners, and tissue-specific roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.