Recombinant Drosophila melanogaster Transmembrane protein 41 homolog (CG8408)

Shipped with Ice Packs
In Stock

Description

Functional Insights & Research Context

Hypothesized Roles:

  • Developmental Regulation: CG8408 belongs to a cohort of embryonically regulated genes encoding transmembrane proteins, suggesting roles in morphogenesis or cell signaling during Drosophila development .

  • Carbohydrate Binding Potential: While CG8408 itself lacks direct evidence, related DM9-motif transmembrane proteins (e.g., CG13321) exhibit carbohydrate-binding activity, hinting at possible lectin-like functions in innate immunity .

Comparative Functional Data:

ProteinFunctionExperimental Evidence
CG13321Mannose/rhamnose bindingGlycan array, ITC assays
CG6234Embryogenesis (germ band retraction)RNAi knockdown phenotypes
CG8408Undetermined (structural homology)Recombinant production only

Research Applications & Limitations

Key Uses:

  • Antibody development (e.g., Rabbit anti-Drosophila stasimon antibodies ).

  • Mechanistic studies of transmembrane protein trafficking or oligomerization .

Challenges:

  • Limited functional data directly linking CG8408 to specific pathways.

  • Commercial availability restricted to research-grade quantities .

Future Directions

  • Functional Knockdown: RNAi or CRISPR-based studies to elucidate developmental roles .

  • Structural Biology: Cryo-EM or crystallography to resolve membrane topology.

  • Interactome Mapping: Identify binding partners via affinity purification-mass spectrometry.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
stas; CG8408; Transmembrane protein 41 homolog; Protein stasimon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
stas
Target Protein Sequence
MSYCSGVAISADEGITMRNGRAKALQEHSPDQVATPLLPQVPPQEQQDLNPQQQQQQQQQ QQATPQKQAMSADEKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDI QDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLI CFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPN WFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMAC ACASLLPGLLKNKFKHKKEA
Uniprot No.

Target Background

Function
Essential for normal neurotransmitter release in cholinergic neurons, but not motor neurons. Plays a role in muscle growth.
Gene References Into Functions
  1. Analysis of SMN target genes identifies Stasimon/CG8408 as a protein required for motor circuit function. PMID: 23063131
Database Links

KEGG: dme:Dmel_CG8408

STRING: 7227.FBpp0074261

UniGene: Dm.194

Protein Families
TMEM41 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
In embryos, strongly expressed in the nervous system.

Q&A

What is the genomic location and structure of the CG8408 gene in Drosophila melanogaster?

CG8408 encodes the Drosophila melanogaster Transmembrane protein 41 homolog, which is part of a conserved family of transmembrane proteins. While the search results don't provide the specific genomic location, typical characterization of Drosophila genes involves identifying their chromosomal position using techniques like polytene chromosome staining as mentioned in the analysis of other genes . The gene structure would include exon-intron boundaries, regulatory regions, and potential binding sites for transcription factors. Understanding genomic structure is crucial for designing targeted genetic manipulations and expression studies.

What expression patterns does CG8408 show during Drosophila development?

Based on approaches used for other Drosophila genes, researchers typically analyze expression patterns throughout developmental stages using techniques like microarray analysis. Similar to studies on sex-differential gene expression during metamorphosis , CG8408 expression could be analyzed across different developmental time points. This would involve isolating RNA from specific developmental stages, followed by quantitative PCR or RNA sequencing to determine temporal expression patterns. Spatial expression patterns would require in situ hybridization or reporter gene constructs to visualize expression in specific tissues.

What are the optimal methods for expressing recombinant CG8408 protein in laboratory settings?

For recombinant expression of Drosophila transmembrane proteins:

  • Expression Systems:

    • Bacterial systems (E. coli): Suitable for protein domains but challenging for full transmembrane proteins

    • Insect cell lines: Preferred for Drosophila proteins (e.g., S2 cells or the CME-W1-cl8+ cell line mentioned in the search results )

    • Yeast expression systems: Useful for eukaryotic membrane proteins

  • Expression Constructs:

    • Gateway cloning or Gibson Assembly for creating expression vectors

    • Addition of affinity tags (His, FLAG, etc.) for purification

    • Codon optimization for the chosen expression system

  • Purification Protocol:

    • Detergent-based membrane protein extraction

    • Affinity chromatography

    • Size exclusion chromatography for final purification

The choice between systems depends on downstream applications and required protein modifications.

What genetic tools are available for studying CG8408 function in vivo?

Based on methodologies described for other Drosophila genes , several genetic approaches can be employed:

  • RNAi-Mediated Knockdown:

    • GAL4-UAS system for tissue-specific knockdown

    • Temperature-sensitive GAL80 for temporal control

    • Multiple RNAi lines to control for off-target effects

  • CRISPR-Cas9 Genome Editing:

    • Gene knockout or precise mutations

    • Endogenous tagging for visualization

    • Homology-directed repair for specific modifications

  • Overexpression Studies:

    • UAS-CG8408 constructs for tissue-specific overexpression

    • Rescue experiments in knockout backgrounds

These approaches would be combined with appropriate phenotypic assays to determine function.

How can protein-protein interactions of CG8408 be identified and validated?

For transmembrane proteins like CG8408, the following approaches would be recommended:

  • In vitro Approaches:

    • Co-immunoprecipitation with tagged CG8408

    • Proximity labeling approaches (BioID or APEX)

    • Split-GFP complementation assays

  • In vivo Approaches:

    • Yeast two-hybrid (for specific domains)

    • Genetic interaction screens in Drosophila

    • Fluorescence resonance energy transfer (FRET)

  • Validation Strategies:

    • Reciprocal co-immunoprecipitation

    • Co-localization studies

    • Functional assays testing effects of disrupting interactions

How does CG8408 participate in transcriptional regulation networks in Drosophila?

While specific information about CG8408's role is not provided in the search results, based on methodology used for other Drosophila proteins, researchers would:

  • Identify Potential Transcriptional Partners:

    • ChIP-seq to identify genomic binding sites

    • Similar to the analysis done for TBPH and Lilli binding sites

    • Analysis of colocalization on polytene chromosomes

  • Characterize Regulatory Effects:

    • RNA-seq following CG8408 manipulation

    • PRO-seq to analyze transcriptional effects

    • Comparison of binding sites with expression changes

  • Integration into Known Networks:

    • Analysis of overlap with known transcriptional regulators

    • Pathway enrichment analysis of affected genes

    • Validation of key interactions using genetic approaches

The research approach would need to determine whether CG8408 directly or indirectly affects transcriptional processes.

What is the role of CG8408 in stress response pathways?

Drawing parallels from studies of other Drosophila proteins involved in stress response :

  • Stress Induction Experiments:

    • Heat shock response analysis

    • Oxidative stress challenges

    • Nutritional stress tests

  • Analysis Approaches:

    • qRT-PCR analysis of stress-induced transcripts

    • Protein localization changes under stress

    • Survival assays with CG8408 mutants under stress

  • Integration with Known Stress Pathways:

    • Examination of interactions with known stress factors

    • Analysis of colocalization with stress-induced loci (similar to the Hsrω locus )

    • Epistasis experiments with established stress pathway components

How do post-translational modifications affect CG8408 function and localization?

For transmembrane proteins, post-translational modifications can significantly impact function:

  • Identification of Modifications:

    • Mass spectrometry analysis of purified protein

    • Site-directed mutagenesis of predicted modification sites

    • Antibodies against specific modifications

  • Functional Impact Analysis:

    • Subcellular localization of modified vs. unmodified protein

    • Protein-protein interaction changes

    • Functional assays comparing wild-type and modification-site mutants

  • Regulatory Mechanisms:

    • Identification of enzymes responsible for modifications

    • Temporal regulation of modifications during development

    • Stress-induced changes in modification patterns

What are common challenges in generating antibodies against CG8408?

For transmembrane proteins like CG8408:

  • Antigen Selection Considerations:

    • Use of extracellular/cytoplasmic domains rather than transmembrane regions

    • Peptide antigens vs. recombinant domain proteins

    • Consideration of post-translational modifications

  • Validation Requirements:

    • Testing in CG8408 knockout/knockdown tissues

    • Western blot analysis with recombinant protein

    • Immunofluorescence specificity testing

  • Alternative Approaches:

    • Epitope tagging of endogenous protein

    • Using orthogonal detection methods

    • Commercial antibody screening strategies

How can specificity issues in CG8408 functional studies be addressed?

To ensure specificity in functional studies:

  • Genetic Controls:

    • Use of multiple independent RNAi lines

    • CRISPR-generated alleles

    • Rescue experiments with RNAi-resistant constructs

  • Expression Validation:

    • qRT-PCR validation of knockdown efficiency

    • Western blot confirmation of protein reduction

    • Off-target effect analysis

  • Phenotypic Validation:

    • Comparison across different genetic approaches

    • Dose-response relationships

    • Tissue-specific manipulation to reduce systemic effects

How should contradictory results in CG8408 expression studies be reconciled?

When facing contradictory data:

  • Methodological Considerations:

    • Different detection sensitivities between techniques

    • Tissue-specific vs. whole-organism analysis

    • Developmental timing differences

  • Systematic Analysis Approach:

    • Direct comparison using identical samples

    • Controls for genetic background effects

    • Meta-analysis of multiple studies

  • Resolution Strategies:

    • Combined approaches with orthogonal techniques

    • Single-cell analysis to detect heterogeneity

    • Consideration of environmental or experimental variables

What statistical approaches are most appropriate for analyzing CG8408 phenotypic data?

Based on approaches used in Drosophila research:

  • For Continuous Variables:

    • ANOVA with appropriate post-hoc tests

    • Linear mixed models for repeated measures

    • Regression analysis for dose-response relationships

  • For Categorical Outcomes:

    • Chi-square analysis

    • Fisher's exact test for small sample sizes

    • Logistic regression for multiple predictors

  • Advanced Considerations:

    • Multiple testing correction (e.g., Benjamini-Hochberg)

    • Sample size determination through power analysis

    • Bootstrapping for non-parametric data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.