Recombinant Drosophila melanogaster Transmembrane protein 70 homolog, mitochondrial (CG7506)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster Transmembrane Protein 70 Homolog

The Recombinant Drosophila melanogaster Transmembrane Protein 70 Homolog, Mitochondrial (CG7506) is a protein of interest in the field of molecular biology, particularly in studies involving mitochondrial function and energy metabolism. This protein is homologous to the human Transmembrane Protein 70 (TMEM70), which plays a crucial role in the assembly of ATP synthase (Complex V) in mitochondria . While specific research on the recombinant version of this protein in Drosophila melanogaster is limited, understanding its function and potential applications requires a comprehensive review of related studies.

Function and Role in Mitochondria

In humans, TMEM70 is essential for the assembly and stabilization of Complex V, which is critical for oxidative phosphorylation, the process by which cells generate most of their energy . Given its homology to human TMEM70, the Drosophila melanogaster Transmembrane Protein 70 Homolog likely serves a similar function in fruit fly mitochondria. This involves facilitating the assembly of ATP synthase, ensuring efficient energy production through the conversion of ADP to ATP.

Research Findings and Implications

While direct research on the recombinant form of this protein is scarce, studies on mitochondrial proteins in Drosophila melanogaster highlight the importance of these proteins in energy metabolism and their potential as models for human diseases . The use of Drosophila as a model organism allows for the exploration of complex biological processes, including those related to mitochondrial function and disease .

Table 1: Comparison of TMEM70 Functions in Humans and Drosophila

FeatureHuman TMEM70Drosophila melanogaster Homolog (CG7506)
LocationMitochondrial inner membraneMitochondrial inner membrane (presumed)
FunctionAssembly of Complex V (ATP synthase)Likely assembly of Complex V (ATP synthase)
Disease AssociationMitochondrial Complex V deficiencyPotential model for studying mitochondrial diseases
Sequence Homology-Homologous to human TMEM70

Potential Applications and Future Research Directions

The study of the Recombinant Drosophila melanogaster Transmembrane Protein 70 Homolog could provide insights into mitochondrial function and disease mechanisms. Given the conservation of mitochondrial pathways across species, this protein could serve as a valuable tool for understanding and modeling human mitochondrial disorders, such as Complex V deficiency . Future research might focus on:

  • Expression and Purification: Developing efficient methods for expressing and purifying the recombinant protein to facilitate biochemical studies.

  • Functional Analysis: Investigating the protein's role in mitochondrial energy metabolism and its potential interactions with other mitochondrial components.

  • Disease Modeling: Utilizing Drosophila models to study the effects of mutations or alterations in mitochondrial function related to human diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG7506; Transmembrane protein 70 homolog, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
65-236
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG7506
Target Protein Sequence
SDDALQRIYYGTLAPRMKMVKFFSLSTSLAGLAAQPILLEQGMKIGGTGMAVFLCTVGGF FTFVTPLLLHFITKKYVTELHYNPLTEEYTATTISLLLQKIKTTFRPNDVVVPEVPGMFT SFLVNKRPLFVDPALFDDPEHYVKIMGYDKPIDFKLDLTPNPEKSKTSEEKQ
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG7506

STRING: 7227.FBpp0076533

UniGene: Dm.3946

Protein Families
TMEM70 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.