Recombinant Drosophila melanogaster Tyramine/octopamine receptor (Oct-TyrR)

Shipped with Ice Packs
In Stock

Description

Introduction to Oct-TyrR in Drosophila melanogaster

Octopamine and tyramine are biogenic amines that serve as neurotransmitters, neuromodulators, and neurohormones in insects, functioning as the invertebrate equivalents of mammalian epinephrine and norepinephrine . These monoamines exert their effects through specialized G protein-coupled receptors (GPCRs) that are classified into distinct subtypes based on their pharmacological properties and signal transduction mechanisms.

In Drosophila melanogaster, researchers have identified four different octopamine receptors (Oamb, Octβ1R, Octβ2R, Octβ3R) and three tyramine receptors (TyrR, TyrRII, TyrRIII) . Among these, the Oct-TyrR (also referred to as OcR, TyrR, or OctyR99AB in some literature) represents a significant receptor subtype that responds to both octopamine and tyramine, explaining its dual nomenclature .

Oct-TyrR plays important roles in regulating various physiological phenomena in insects, including memory formation, sleep patterns, grooming behaviors, and aggressive responses . The significance of this receptor extends beyond basic neurobiology, as understanding its molecular characteristics and functions potentially offers targets for developing novel insecticides and pest management strategies.

Protein Structure and Properties

The recombinant full-length Drosophila melanogaster Oct-TyrR protein is typically expressed in E. coli expression systems with fusion tags, particularly histidine tags, to facilitate purification and experimental applications . The full mature protein spans amino acid residues 27-601 of the native sequence and exhibits structural features characteristic of G protein-coupled receptors, including seven transmembrane domains .

The amino acid sequence of the recombinant Oct-TyrR protein has been well-characterized and includes multiple functional domains necessary for ligand binding and signal transduction. The protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis . For research applications, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C, avoiding repeated freeze-thaw cycles which may compromise its functionality .

Gene Information

The Oct-TyrR gene (also designated as Oct-TyrR, OcR, OctyR99AB, TYR, TyrR, or CG7485 in various databases) encodes the octopamine/tyramine receptor protein . The gene has been thoroughly characterized at the molecular level, facilitating the production of recombinant forms for research purposes. Understanding the genetic structure of Oct-TyrR has enabled researchers to develop various mutant and transgenic models to study its functions in vivo.

Nervous System Expression

Oct-TyrR shows a distinctive expression pattern in the Drosophila nervous system. Expression analysis studies have revealed that Oct-TyrR, like other octopamine and tyramine receptors, is strongly expressed in the mushroom bodies, which are centers for learning and memory in insects .

Beyond the mushroom bodies, Oct-TyrR expression has been documented in several regions of the central nervous system (CNS). Research utilizing T2A-Gal4 and Trojan-Gal4 lines to visualize Oct-TyrR expression has confirmed its presence in the pars intercerebralis (PI), the ellipsoid body (EB) of the central complex, the mushroom body (MB), and the ventral nerve cord (VNC) .

These expression patterns align with the functional roles of Oct-TyrR in modulating behaviors such as locomotion, grooming, and responses to starvation, as these brain regions are known to regulate such behaviors in Drosophila .

Peripheral Expression

Outside the central nervous system, the expression patterns of octopamine and tyramine receptors vary substantially. While detailed information specifically about Oct-TyrR peripheral expression is limited in the available search results, research on the family of octopamine and tyramine receptors indicates differential expression in tissues such as the tracheal system, heart muscles, oenocytes, and skeletal muscles .

Common to all octopamine and tyramine receptors is their expression in mushroom bodies, confirming the significance of these neuromodulatory systems in learning and memory functions . This shared characteristic highlights the evolutionary importance of these signaling pathways in insect behavior.

Locomotor Activity Regulation

One of the key functions of Oct-TyrR is the regulation of locomotor activity in Drosophila. Studies using hypomorphic mutants and knockdown models of Oct-TyrR have demonstrated decreased locomotor activity, particularly evident in reduced evening peak activity under standard 12h:12h light and dark conditions .

Oct-TyrR hypomorphic mutant flies show a significant decrease in locomotor activity compared to wild-type flies . Furthermore, pan-neuronal knockdown of Oct-TyrR using RNA interference approaches produces similar reductions in locomotion, suggesting that Oct-TyrR expressed in neurons plays a critical role in maintaining normal activity levels .

Interestingly, the expression of Oct-TyrR in the pars intercerebralis, a brain region that receives projections from octopaminergic neurons, appears to be particularly important for controlling locomotor activity . This regional specificity provides insights into the neural circuits through which Oct-TyrR mediates its effects on behavior.

Grooming Behavior

Oct-TyrR signaling appears to play an inhibitory role in grooming behavior regulation. Hypomorphic Oct-TyrR mutants exhibit increased time and frequency of grooming compared to wild-type flies . This observation suggests that normal Oct-TyrR function serves to suppress excessive grooming behavior.

Decapitated wild-type flies treated with octopamine show increased grooming time, while Oct-TyrR hypomorphic mutants treated with octopamine do not exhibit significant changes in grooming behavior . These findings indicate that octopamine signaling via Oct-TyrR normally acts to inhibit grooming, and that this regulatory mechanism is disrupted in Oct-TyrR mutants.

Starvation-Induced Hyperactivity

Starvation typically induces hyperactivity in Drosophila, a behavioral response that may facilitate food-seeking. Oct-TyrR appears to be essential for this adaptive response, as Oct-TyrR hypomorphic mutants show inhibition of starvation-induced hyperactivity . This suggests that Oct-TyrR signaling normally promotes increased locomotor activity in response to food deprivation, potentially enhancing survival by facilitating foraging behavior.

Receptor Pharmacology

Oct-TyrR exhibits characteristic pharmacological properties that distinguish it as a member of the octopamine/tyramine receptor family. As its name suggests, this receptor responds to both octopamine and tyramine as primary agonists .

Studies have shown that while Oct-TyrR responds robustly to octopamine, it does not respond to serotonin (5-HT) at concentrations ranging from 10^-8 to 10^-4 M . This pharmacological profile helps differentiate Oct-TyrR from serotonin receptors and other biogenic amine receptors in Drosophila.

Agonist and Antagonist Profiles

Several antagonists effectively block octopamine-induced signaling through Oct-TyrR. Phentolamine (PA), epinastine (EP), and yohimbine (YO) have been shown to inhibit octopamine-induced responses in cells expressing Oct-TyrR . Specifically, octopamine-induced cellular responses at 10^-5 M can be reduced by more than 90% by 10^-6 M or higher concentrations of epinastine and phentolamine, and by 10^-5 M yohimbine .

Table 2: Pharmacological Properties of Oct-TyrR

ParameterValue/Observation
Primary AgonistsOctopamine, Tyramine
Non-responsive toSerotonin (5-HT) at 10^-8 to 10^-4 M
Effective AntagonistsPhentolamine, Epinastine, Yohimbine
IC50 of Epinastine1.0 × 10^-7 M
IC50 of Phentolamine9.3 × 10^-8 M
IC50 of Yohimbine1.8 × 10^-5 M

These pharmacological characteristics provide valuable tools for manipulating Oct-TyrR signaling in experimental settings and offer potential targets for the development of insecticides that specifically disrupt octopamine/tyramine signaling in pest species.

Experimental Usage

The recombinant Oct-TyrR protein has numerous applications in research settings. It can be used for SDS-PAGE analysis, antibody production, and various biochemical and pharmacological studies . The availability of purified recombinant protein facilitates investigations into receptor structure, ligand binding properties, and signal transduction mechanisms.

Genetic and Behavioral Studies

Genetic tools based on the Oct-TyrR gene, such as T2A-Gal4 and Trojan-Gal4 lines, have been developed to facilitate expression studies and functional analyses . These tools enable precise manipulation of Oct-TyrR expression in specific tissues or cell types, allowing researchers to dissect the contributions of Oct-TyrR signaling to various behaviors and physiological processes.

Hypomorphic mutants and RNAi-mediated knockdown models of Oct-TyrR have proven valuable for behavioral studies, revealing the roles of this receptor in locomotor activity, grooming behavior, and responses to starvation . Such genetic approaches continue to expand our understanding of Oct-TyrR function in vivo.

Comparison with Other Drosophila Receptors

Oct-TyrR belongs to a family of seven receptors in Drosophila that respond to octopamine and tyramine. This family includes four octopamine receptors (Oamb, Octβ1R, Octβ2R, Octβ3R) and three tyramine receptors (TyrR, TyrRII, TyrRIII) . While all these receptors share common expression in mushroom bodies, they differ in their expression patterns in other tissues, pharmacological properties, and downstream signaling mechanisms .

These differences likely reflect functional specialization, allowing each receptor to contribute uniquely to the complex behavioral and physiological effects of octopamine and tyramine in Drosophila.

Relevance to Other Species

Research on octopamine/tyramine receptors in other arthropods reveals evolutionary conservation of these signaling systems. For example, studies on the octopamine/tyramine receptor gene (OCT/Tyr) in Rhipicephalus (Boophilus) decoloratus ticks have shown 91-100% sequence identity to related genes in other tick species .

Interestingly, mutations in the OCT/Tyr gene have been associated with resistance to acaricides in tick populations, with up to 24 single nucleotide polymorphisms (SNPs) found in the OCT/Tyr gene from ticks in high acaricide pressure areas, compared to only 8 from low acaricide pressure areas . These findings suggest potential applications of Oct-TyrR research in understanding and addressing pesticide resistance in agricultural and veterinary contexts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Oct-TyrR; OcR; OctyR99AB; TYR; TyrR; CG7485; Tyramine/octopamine receptor; Tyr/Oct-Dro
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-601
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Oct-TyrR
Target Protein Sequence
VSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGEC EGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNF FIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALD RYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQ RGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSS PVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDP QQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGG GHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKT SGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKN FITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN
Uniprot No.

Target Background

Function

This receptor binds both octopamine and tyramine, invertebrate neurotransmitters and neuromodulators. Its activity is G protein-mediated, activating adenylyl cyclase. Agonist potency follows this order: tyramine > octopamine > dopamine > epinephrine > norepinephrine > serotonin > histamine. Antagonist potency is: yohimbine > chlorpromazine > phentolamine > mianserine > cyproheptadine > dihydroergotamine > clonidine > synephrine. Tyramine plays a functional role as a neurotransmitter or neuromodulator in the olfactory system.

Gene References Into Functions
  1. Research indicates a small population of male-specific octopamine (OA) receptor neurons that uniquely modulate the effect of OA on aggression, independently of arousal. PMID: 28858617
  2. Site-directed mutagenesis studies demonstrate the receptor's binding affinity for various amino acids. PMID: 12535676
  3. Studies correlate cellular changes with the insecticidal activity of certain plant essential oils, suggesting that the toxicity of at least two compounds is mediated through the tyramine receptor. PMID: 15763467
Database Links

KEGG: dme:Dmel_CG7485

STRING: 7227.FBpp0078132

UniGene: Dm.3507

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed in Drosophila heads.

Q&A

What is the Oct-TyrR receptor and how does it differ from other aminergic receptors in Drosophila?

The Oct-TyrR receptor (also known as CG7485 or DmTAR1) is a G protein-coupled receptor in Drosophila melanogaster that responds to both octopamine and tyramine, which are biogenic amines that function as neuromodulators in insects. Oct-TyrR belongs to the Tyramine 1 subgroup of receptors that are better activated by tyramine than octopamine. The Drosophila genome contains multiple GPCRs activated by biogenic amines, but Oct-TyrR is structurally distinct from other tyramine receptors like TyrR (CG7431) and TyrRII (CG16766), sharing only moderate sequence similarity (CG7431: 30% identical and 47% similar; CG16766: 44% identical and 65% similar) .

Unlike the highly tyramine-specific receptor TyrR, Oct-TyrR demonstrates broader ligand responsiveness, being activated by both octopamine and tyramine. It is one of six octopamine receptors in Drosophila, alongside OAMB, Octα2R, Octβ1R, Octβ2R, and Octβ3R, each with distinct expression patterns and functional properties .

Where is Oct-TyrR expressed in Drosophila melanogaster tissues?

Oct-TyrR shows a specific expression pattern in Drosophila tissues. In the female reproductive tract, Oct-TyrR is expressed in neurons and neuronal processes but not in epithelial cells. Fine processes that express Oct-TyrR extend into the ovary . Using MiMIC-T2A-Gal4 lines for visualization, researchers have demonstrated that Oct-TyrR-expressing cells in the reproductive tract exhibit morphology strongly suggesting they are neurons, similar to cells expressing other octopamine receptors (Octα2R, Octβ1R, and Octβ3R) that colocalize with the neuronal marker ppk1.0-LexA .

Beyond the reproductive system, Oct-TyrR is also expressed in the central nervous system of Drosophila. The expression of Oct-TyrR and other octopamine/tyramine receptors in the CNS suggests their involvement in modulating various behaviors and physiological processes in the fly.

What signaling pathways are activated by Oct-TyrR?

Oct-TyrR primarily couples to G proteins that influence cyclic AMP (cAMP) levels in the cell. Unlike the highly tyramine-specific receptor TyrR which couples to Gq and leads to calcium release, Oct-TyrR can be activated by multiple biogenic amines including octopamine, dopamine, noradrenaline, and adrenaline, all of which are capable of elevating cAMP levels .

The receptor's coupling to G proteins that regulate cAMP suggests involvement in neuromodulatory functions similar to those of adrenergic receptors in vertebrates. In insects, this signaling pathway likely contributes to the regulation of various physiological processes, including neuronal excitability, muscle contraction, and behavioral outputs regulated by aminergic signaling.

What expression systems are optimal for recombinant Oct-TyrR production and functional studies?

For recombinant Oct-TyrR expression and functional studies, several expression systems have proven effective, with Chinese hamster ovary (CHO) cells being particularly useful. When studying Oct-TyrR pharmacology, researchers typically:

  • Clone the full-length Oct-TyrR cDNA into expression vectors with strong promoters (e.g., CMV for mammalian cells)

  • Transfect the construct into CHO cells using either transient or stable transfection methods

  • Confirm expression using Western blotting with receptor-specific antibodies or epitope tags

  • Conduct functional assays to assess receptor activity

CHO cells are advantageous because they have low endogenous expression of similar receptors and provide a mammalian cellular environment for proper protein folding and post-translational modifications. For more native-like studies, Drosophila S2 cells can be used, though they may express endogenous receptors that could complicate interpretation of results .

For in vivo studies, the GAL4-UAS system in Drosophila provides a powerful approach for tissue-specific expression of Oct-TyrR. MiMIC-T2A-GAL4 lines have been particularly valuable for mapping the endogenous expression patterns of Oct-TyrR in the fly nervous system and reproductive tract .

How can researchers measure Oct-TyrR activation and signaling in experimental settings?

Researchers can employ several complementary approaches to measure Oct-TyrR activation and downstream signaling:

  • cAMP Assays: Since Oct-TyrR modulates cAMP levels, researchers use commercially available ELISA-based cAMP assays or FRET-based biosensors (such as Epac-based sensors) to detect real-time changes in cAMP concentration within cells expressing the receptor.

  • Calcium Imaging: Despite primary coupling to cAMP pathways, secondary calcium responses can be measured using calcium-sensitive dyes (Fluo-4, Fura-2) or genetically encoded calcium indicators (GCaMPs) to detect potential cross-talk with calcium signaling pathways.

  • Receptor Internalization Assays: Following activation, GPCRs often undergo internalization. This can be visualized using fluorescently tagged receptors or antibody-based detection of surface expression.

  • Electrophysiology: In native neurons expressing Oct-TyrR, patch-clamp recordings can measure changes in membrane potential or current in response to agonist application.

  • Optogenetic Approaches: For in vivo studies, researchers have used the UAS-trpA1 system to transiently activate Oct-TyrR-expressing neurons and observe the resulting behavioral effects .

How does Oct-TyrR contribute to Drosophila reproductive physiology?

Oct-TyrR plays a significant role in Drosophila reproductive physiology, particularly in females. Neuroimaging and behavioral studies have revealed several key contributions:

  • Neuronal Regulation: Oct-TyrR is expressed in neurons within the female reproductive tract, specifically in fine processes that extend into the ovary, suggesting a role in neural control of reproductive functions .

  • Reproductive Tract Function: While Oct-TyrR is not expressed in epithelial or muscle cells of the reproductive tract (unlike OAMB and Octβ2R), the neurons expressing Oct-TyrR likely modulate reproductive tract activity through synaptic or paracrine signaling mechanisms.

  • Egg-Laying Regulation: The aminergic signaling system, including octopamine and tyramine, is critical for egg-laying behavior in Drosophila. The expression of Oct-TyrR in the reproductive tract suggests its involvement in this process, though its precise contribution relative to other octopamine receptors like OAMB and Octβ2R (which have established roles in egg-laying) requires further investigation .

  • Sperm Storage Modulation: Octopamine stimulates calcium transients in sperm storage organs, and various octopamine receptors, potentially including Oct-TyrR, may participate in regulating this process .

The specific contribution of Oct-TyrR to these processes is still being elucidated, but its neuronal expression pattern suggests it mediates communication between the nervous system and reproductive organs to coordinate reproductive behaviors and physiology.

What is known about Oct-TyrR's role in modulating Drosophila behavior?

Oct-TyrR contributes to several aspects of Drosophila behavior through its neuromodulatory actions:

  • Olfactory Processing: Oct-TyrR affects odor avoidance behavior. Mutations affecting the Oct-TyrR receptor result in reduced odor avoidance, demonstrating its role in olfactory processing and response .

  • Male Courtship Behavior: While the highly tyramine-specific receptor TyrR has been shown to regulate male courtship drive (with TyrR knockout leading to elevated male-male courtship in the absence of females), Oct-TyrR may also participate in regulating aspects of reproductive behavior through its expression in the nervous system .

  • Locomotor Activity: Aminergic signaling broadly regulates Drosophila locomotion, and Oct-TyrR likely contributes to this regulation. Researchers have used climbing assays to assess the effects of manipulating octopamine receptor activity, which can be applied to study Oct-TyrR's specific contributions .

  • Stress Responses: As an ortholog of vertebrate adrenergic receptors, Oct-TyrR may participate in stress-related behaviors and physiological responses in Drosophila, though this remains to be fully characterized.

Understanding Oct-TyrR's precise contributions to these behaviors often requires genetic approaches, such as receptor-specific knockouts or selective manipulation of Oct-TyrR-expressing neurons, due to the overlapping functions of multiple aminergic receptors.

How do Oct-TyrR dynamics compare with mammalian adrenergic receptors at the molecular level?

Oct-TyrR and mammalian adrenergic receptors share important structural and functional similarities despite their evolutionary distance, but also exhibit key differences:

Structural Homology:

  • Oct-TyrR and mammalian adrenergic receptors both belong to the Class A (rhodopsin-like) G protein-coupled receptor superfamily, sharing the characteristic seven-transmembrane domain architecture.

  • The orthosteric binding site of Oct-TyrR, like mammalian adrenergic receptors, involves residues in transmembrane domains 3, 5, 6, and 7 .

  • Key residues for biogenic amine binding are conserved between Oct-TyrR and mammalian adrenergic receptors, reflecting their shared evolutionary origin.

Pharmacological Differences:

  • Oct-TyrR responds to both tyramine and octopamine, with tyramine typically being more potent. In contrast, mammalian α- and β-adrenergic receptors preferentially bind norepinephrine and epinephrine.

  • Oct-TyrR exhibits a broader ligand responsiveness compared to the highly selective TyrR receptor, making it functionally more similar to mammalian adrenergic receptors in terms of promiscuity.

  • The receptor shows distinct pharmacological profiles in response to synthetic agonists and antagonists compared to mammalian adrenergic receptors .

Signaling Mechanisms:

  • While mammalian adrenergic receptors couple to specific G protein subtypes (Gαs, Gαi, or Gαq), Oct-TyrR appears capable of promiscuous G protein coupling, potentially activating multiple downstream pathways.

  • This promiscuous coupling may involve both G protein-dependent and -independent signaling mechanisms, similar to the complexity observed in mammalian systems.

Understanding these molecular similarities and differences can provide insights into the evolution of aminergic signaling systems and may aid in the development of selective compounds for research or pest control applications.

What genetic approaches are most effective for studying Oct-TyrR function in vivo?

Several genetic approaches have proven effective for studying Oct-TyrR function in Drosophila:

  • Receptor-Specific Knockout Lines: CRISPR/Cas9-mediated gene editing can generate precise Oct-TyrR null mutants for loss-of-function studies. These allow researchers to assess the specific contribution of Oct-TyrR to various physiological processes and behaviors without affecting other aminergic receptors.

  • MiMIC-Based Expression Systems: MiMIC-T2A-Gal4 lines provide a powerful tool for mapping Oct-TyrR expression patterns with high fidelity. These lines have been used to demonstrate Oct-TyrR expression in neurons within the reproductive tract and central nervous system .

  • Cell-Type Specific Manipulation: The GAL4-UAS system allows for targeted expression or knockdown of Oct-TyrR in specific cell populations:

    • UAS-RNAi lines for cell-specific receptor knockdown

    • UAS-Oct-TyrR for rescue or overexpression studies

    • UAS-trpA1 or UAS-Shibire^ts for activating or silencing Oct-TyrR-expressing neurons, respectively

  • Genetic Reporters: GRASP (GFP Reconstitution Across Synaptic Partners) technique can identify synaptic connections involving Oct-TyrR-expressing neurons, similar to approaches used with other aminergic receptor systems .

  • Functional Imaging: Genetically encoded calcium indicators (GCaMPs) or cAMP sensors targeted to Oct-TyrR-expressing cells allow for monitoring physiological responses in intact flies or ex vivo preparations.

  • MARCM Technique: Mosaic Analysis with a Repressible Cell Marker can generate labeled single-cell clones lacking Oct-TyrR to study cell-autonomous receptor functions.

These approaches can be combined with behavioral assays, such as courtship assays, climbing tests, egg-laying assays, or olfactory response paradigms, to correlate molecular and cellular changes with organismal phenotypes.

What are the comparative pharmacological properties of Oct-TyrR versus other octopamine/tyramine receptors?

The pharmacological properties of Oct-TyrR differ significantly from other octopamine and tyramine receptors in Drosophila, as summarized in the following table:

ReceptorPrimary Ligand PreferenceG Protein CouplingSecond MessengerExpression PatternPharmacological Profile
Oct-TyrR (CG7485)Tyramine > OctopamineMixed (likely Gi/Gs)cAMP modulationNeurons in CNS and reproductive tractActivated by multiple biogenic amines including dopamine and noradrenaline
TyrR (CG7431)Tyramine only (high specificity)GqCalcium releaseVarious tissues including male-specific neurons (IPS)Highly selective for tyramine; not activated by octopamine, dopamine, serotonin or histamine up to 100 μM
TyrRII (CG16766)Tyramine > OctopamineMixedMultiple pathwaysSimilar to TyrR but more restrictedBroader agonist profile than TyrR
OAMBOctopamine > TyramineGq/GsCa²⁺ and cAMPReproductive tract epithelium, CNSKey role in egg-laying; calcium responses in spermathecal secretory cells
Octβ2ROctopamine > TyramineGscAMP increaseReproductive tract epithelium and musclePotential insecticide target; mediates oviduct contractions
Octα2R, Octβ1R, Octβ3ROctopamine > TyramineVariousVariousNeurons in reproductive tractContribute to regulation of reproductive tract function

Key differences in Oct-TyrR pharmacology include:

  • Ligand Specificity: Unlike the highly selective TyrR that responds only to tyramine, Oct-TyrR responds to multiple biogenic amines, including octopamine, dopamine, noradrenaline, and adrenaline .

  • Signal Transduction: While TyrR couples primarily to Gq and calcium signaling, Oct-TyrR appears to predominantly modulate cAMP levels, suggesting different G protein coupling preferences .

  • Agonist Response: Oct-TyrR shows distinct patterns of activation and internalization when exposed to different agonists compared to other tyramine receptors. For example, CG16766 (TyrRII) is internalized by multiple biogenic amines, whereas TyrR is only internalized after activation by tyramine .

  • Expression Pattern: Oct-TyrR shows a unique expression pattern compared to other octopamine receptors, with expression primarily in neurons within the reproductive tract rather than in epithelial or muscle cells (where OAMB and Octβ2R are expressed) .

Understanding these pharmacological differences is crucial for developing selective tools to manipulate specific receptor systems and for potential applications in insecticide development.

How conserved is Oct-TyrR across insect species and what does this reveal about its evolutionary significance?

The Oct-TyrR receptor shows variable conservation across insect species, providing insights into its evolutionary history and functional significance:

  • Phylogenetic Distribution: While orthologs of TyrR (CG7431) are found in numerous insect species, Oct-TyrR shows a more specific distribution. Some closely related tyramine receptors, such as CG16766 (proposed as TyrRIII), appear to be limited to Drosophila species, suggesting relatively recent gene duplication events .

  • Structural Conservation: The basic seven-transmembrane domain structure characteristic of Class A GPCRs is highly conserved across species. Key residues involved in ligand binding and G protein coupling show notable conservation, reflecting functional constraints on receptor evolution.

  • Functional Divergence: Despite structural similarities, functional specialization is evident across species. The variation in ligand specificity, G protein coupling preferences, and expression patterns between species suggests adaptation to different ecological niches and behavioral requirements.

  • Evolutionary Origin: Octopamine and tyramine receptors in insects are considered functional homologs of adrenergic receptors in vertebrates. Oct-TyrR's broader ligand responsiveness compared to the highly specific TyrR may represent an intermediate evolutionary state in the specialization of aminergic receptors.

The evolutionary conservation pattern of Oct-TyrR suggests it plays important roles in fundamental neurophysiological processes, while species-specific variations likely reflect adaptations to different ecological niches and behavioral requirements. This evolutionary perspective provides valuable context for understanding Oct-TyrR function and potential applications in comparative neuroethology and pest control research.

What potential does Oct-TyrR hold as a target for selective insecticide development?

Oct-TyrR presents several characteristics that make it a promising candidate for selective insecticide development:

  • Phylogenetic Specificity: Oct-TyrR belongs to a receptor family that is present in invertebrates but absent in vertebrates. This fundamental difference provides a basis for developing compounds that selectively target insect physiology without affecting mammals, birds, or other vertebrates .

  • Functional Importance: The involvement of Oct-TyrR in key physiological processes and behaviors in insects makes it a potentially effective target for disrupting pest life cycles or behaviors. Compounds that inappropriately activate or block Oct-TyrR could disrupt normal insect physiology or behavior.

  • Structural Distinctiveness: The differences in binding pocket architecture between insect Oct-TyrR and mammalian aminergic receptors create opportunities for designing highly selective compounds that bind exclusively to the insect receptor.

  • Species Selectivity Potential: Variation in Oct-TyrR structure between beneficial insects (like pollinators) and pest species could potentially be exploited to develop insecticides that target specific pest groups while sparing beneficial insects. As noted in search result : "Since the structure and pharmacology of Octβ2R is different between mites and bees, our findings will help target-based screening and the design of novel chemicals acting on this unique molecular target."

  • Natural Product Leads: Some plant-derived essential oils show insecticidal properties and act on octopamine receptors, suggesting natural product scaffolds that could be optimized for Oct-TyrR selectivity .

Research approaches for developing Oct-TyrR-targeted insecticides include:

  • High-throughput screening of compound libraries against recombinant Oct-TyrR

  • Structure-based design utilizing homology models of the receptor

  • Behavioral assays in Drosophila to validate potential compounds, such as the climbing assays mentioned in search result

  • Comparison of effects across species to assess selectivity

The unique properties of Oct-TyrR make it a promising target for developing next-generation pest control agents with improved selectivity and reduced environmental impact.

What are the major technical challenges in purifying and crystallizing Oct-TyrR for structural studies?

Researchers face several significant challenges when attempting to purify and crystallize Oct-TyrR for structural studies:

  • Protein Expression Levels: As a seven-transmembrane GPCR, Oct-TyrR is difficult to express at high levels required for structural studies. The hydrophobic nature of the protein often leads to aggregation, misfolding, or toxicity to the expression host.

  • Membrane Protein Stability: Once extracted from the membrane environment, Oct-TyrR tends to be unstable and can rapidly denature. This instability complicates purification procedures and subsequent crystallization attempts.

  • Conformational Heterogeneity: GPCRs like Oct-TyrR exist in multiple conformational states (active, inactive, intermediate), creating a heterogeneous protein population that hinders crystal formation. This is particularly challenging for Oct-TyrR, which may couple to multiple G proteins.

  • Lipid Requirements: Oct-TyrR function depends on specific lipid environments, and stripping away these lipids during purification can lead to loss of native structure and function.

  • Post-translational Modifications: Insect expression systems may provide different post-translational modifications than occur in native Drosophila cells, potentially affecting receptor structure and function.

Technical approaches to overcome these challenges include:

  • Fusion Protein Strategies: Creating fusion constructs with stabilizing proteins such as T4 lysozyme or BRIL to improve expression and crystallization properties.

  • Thermostabilizing Mutations: Introducing point mutations that enhance thermostability without altering the native conformation of the receptor.

  • Lipidic Cubic Phase Crystallization: Utilizing lipidic mesophases that provide a membrane-like environment for crystallization of Oct-TyrR.

  • Nanobody Co-crystallization: Employing conformation-specific nanobodies that bind and stabilize specific receptor states to reduce conformational heterogeneity.

  • Cryo-EM Approaches: As an alternative to crystallization, cryo-electron microscopy can be used to determine the structure of Oct-TyrR in complex with G proteins or other signaling partners.

What emerging technologies might advance our understanding of Oct-TyrR function in the next decade?

Several emerging technologies show promise for advancing our understanding of Oct-TyrR function in the coming decade:

  • Cryo-Electron Microscopy (Cryo-EM): Advances in cryo-EM will likely enable high-resolution structural determination of Oct-TyrR in different conformational states and in complex with various signaling partners, providing insights into activation mechanisms and signaling specificity.

  • Single-Cell Transcriptomics: Application of single-cell RNA sequencing to Oct-TyrR-expressing neurons will reveal their molecular identities, developmental trajectories, and potential functional heterogeneity within seemingly uniform populations.

  • Spatial Transcriptomics: These techniques will map Oct-TyrR expression with unprecedented spatial resolution, revealing its distribution across brain regions and peripheral tissues with cellular and subcellular precision.

  • Advanced Optogenetics and Chemogenetics: Next-generation tools will allow temporally precise control of Oct-TyrR-expressing neurons with improved spatial resolution, enabling dissection of their contributions to specific behaviors and physiological processes.

  • Biosensors for Receptor Activation: Development of FRET or BRET-based sensors that report Oct-TyrR conformational changes will enable real-time visualization of receptor activation in live animals during naturalistic behaviors.

  • Genome Editing with Precision Modifications: Enhanced CRISPR technologies will facilitate introduction of specific mutations in Oct-TyrR to probe structure-function relationships and signaling biases in vivo.

  • Computational Approaches: Advanced molecular dynamics simulations and machine learning techniques will predict Oct-TyrR interactions with ligands and downstream effectors, guiding experimental designs and drug discovery efforts.

  • Multi-modal Neural Recording Techniques: Simultaneous measurement of neural activity, neuromodulator release, and behavior will reveal how Oct-TyrR activation shapes neural circuit function in behaving animals.

These technological advancements will collectively provide a more comprehensive understanding of how Oct-TyrR contributes to insect physiology and behavior, potentially revealing new applications in neuroscience, pest control, and comparative biology.

How might computational modeling enhance our understanding of Oct-TyrR ligand interactions and selectivity?

Computational modeling approaches offer powerful tools for understanding Oct-TyrR ligand interactions and selectivity at the molecular level:

  • Homology Modeling: Since crystal structures of Oct-TyrR are not yet available, homology models based on related GPCRs with solved structures provide a starting point for understanding the receptor's three-dimensional architecture. These models can identify key residues in the orthosteric binding site, which in Class A GPCRs typically involves transmembrane domains 3, 5, 6, and 7 .

  • Molecular Docking: Virtual screening of compound libraries against Oct-TyrR homology models can identify potential ligands and predict their binding modes. This approach can efficiently screen thousands of compounds to identify those with the highest probability of selective binding.

  • Molecular Dynamics Simulations: These simulations can model the dynamic behavior of Oct-TyrR in a lipid bilayer environment, revealing conformational changes associated with ligand binding and receptor activation. Long-timescale simulations can capture transitions between inactive and active states, providing insights into the activation mechanism.

  • Quantum Mechanical Calculations: For detailed analysis of ligand-receptor interactions, quantum mechanical methods can calculate interaction energies with high precision, accounting for electronic effects that classical force fields might miss.

  • Machine Learning Approaches: Machine learning algorithms trained on existing octopamine/tyramine receptor ligands can identify chemical features associated with selectivity for Oct-TyrR over other aminergic receptors, guiding the design of more selective compounds.

  • Free Energy Calculations: Methods such as free energy perturbation (FEP) or thermodynamic integration can quantify binding affinities and selectivity profiles, helping to understand why certain ligands prefer Oct-TyrR over related receptors.

  • Allosteric Site Identification: Computational methods can identify potential allosteric binding sites unique to Oct-TyrR, which may offer opportunities for developing highly selective modulators that do not compete with endogenous ligands.

  • Evolutionary Analysis: Computational comparison of Oct-TyrR sequences across species can identify conserved residues critical for function versus variable regions that might be exploited for species-selective targeting.

These computational approaches, integrated with experimental validation, can significantly accelerate the development of selective Oct-TyrR ligands for research tools and potential pest control applications while providing fundamental insights into receptor biology.

What are the key publications that established fundamental knowledge about Oct-TyrR?

The following publications represent seminal work in establishing our understanding of Oct-TyrR:

  • Evans, P.D. and Maqueira, B. (2005). Insect octopamine receptors: a new classification scheme based on studies of cloned Drosophila G-protein coupled receptors. Invertebrate Neuroscience, 5(3-4), 111-118.

    • This paper proposed a new classification scheme for insect octopamine receptors, providing the framework for understanding Oct-TyrR's place within the broader receptor family.

  • Balfanz, S., Strünker, T., Frings, S., and Baumann, A. (2005). A family of octopamine receptors that specifically induce cyclic AMP production or Ca2+ release in Drosophila melanogaster. Journal of Neurochemistry, 93(2), 440-451.

    • This study characterized the pharmacological properties and signaling mechanisms of Drosophila octopamine receptors, including Oct-TyrR.

  • Maqueira, B., Chatwin, H., and Evans, P.D. (2005). Identification and characterization of a novel family of Drosophila β-adrenergic-like octopamine G-protein coupled receptors. Journal of Neurochemistry, 94(2), 547-560.

    • This paper identified the β-adrenergic-like properties of certain octopamine receptors in Drosophila, contributing to our understanding of Oct-TyrR's relationship to vertebrate adrenergic receptors.

  • El-Kholy, S., Stephano, F., Li, Y., Bhandari, A., Fink, C., and Roeder, T. (2015). Expression analysis of octopamine and tyramine receptors in Drosophila. Cell and Tissue Research, 361(3), 669-684.

    • This comprehensive study mapped the expression patterns of all octopamine and tyramine receptors in Drosophila, including Oct-TyrR, providing critical information about potential functional roles .

  • Bayliss, A., Roselli, G., and Evans, P.D. (2013). A comparison of the signalling properties of two tyramine receptors from Drosophila. Journal of Neurochemistry, 125(1), 37-48.

    • This paper compared the signaling properties of different tyramine receptors, helping to distinguish Oct-TyrR's unique pharmacological profile .

  • McKinney, H., Sherer, L.M., Williams, J.L., Certel, S.J., and Stowers, R.S. (2020). Characterization of Drosophila octopamine receptor neuronal expression using MiMIC-converted Gal4 lines. Journal of Comparative Neurology, 528(12), 2102-2127.

    • This study provided detailed expression mapping of octopamine receptors using the MiMIC-T2A-Gal4 system, which has been instrumental in defining Oct-TyrR's expression pattern .

What datasets and resources are available for researchers studying Oct-TyrR?

Researchers studying Oct-TyrR have access to several valuable resources and datasets:

  • Genetic Resources:

    • Bloomington Drosophila Stock Center: Maintains MiMIC-T2A-Gal4 lines for Oct-TyrR expression studies

    • Vienna Drosophila Resource Center: Offers UAS-RNAi lines for Oct-TyrR knockdown studies

    • FlyBase (https://flybase.org): Comprehensive database containing Oct-TyrR gene information, expression data, and mutant phenotypes

  • Sequence and Structural Data:

    • UniProt (https://www.uniprot.org): Curated protein sequence and functional information for Oct-TyrR

    • GPCRDB (https://gpcrdb.org): Database of GPCR sequences, structures, and mutations, including Oct-TyrR

    • Protein Data Bank (https://www.rcsb.org): Repository of protein structures, including related GPCRs that can be used for homology modeling of Oct-TyrR

  • Expression Data:

  • Pharmacological Resources:

    • ChEMBL (https://www.ebi.ac.uk/chembl/): Database of bioactive molecules with drug-like properties, including compounds tested on octopamine/tyramine receptors

    • IUPHAR/BPS Guide to Pharmacology (https://www.guidetopharmacology.org): Curated information on the pharmacology of GPCRs, including octopamine and tyramine receptors

  • Methodology Protocols:

    • Drosophila Protocols (Cold Spring Harbor): Standardized protocols for Drosophila genetics, imaging, and behavioral assays relevant to Oct-TyrR research

    • G Protein-Coupled Receptor Protocols: Specialized methodologies for GPCR expression, purification, and functional characterization

  • Bioinformatics Tools:

    • GPCRdb Tools (https://gpcrdb.org/services): Specialized tools for GPCR sequence analysis, structure prediction, and ligand binding site identification

    • Molecular Operating Environment (MOE): Software for molecular modeling and simulation of Oct-TyrR and ligand interactions

These resources collectively provide a comprehensive toolkit for researchers investigating Oct-TyrR structure, function, expression, and pharmacology, facilitating both basic research and applied studies in insecticide development.

What are the most significant unanswered questions about Oct-TyrR that warrant further investigation?

Several critical questions about Oct-TyrR remain unanswered and represent important directions for future research:

  • Structural Determinants of Ligand Selectivity: What specific amino acid residues and structural features determine Oct-TyrR's ability to respond to both octopamine and tyramine, and how does this differ from highly selective receptors like TyrR?

  • Signaling Bias and Functional Outcomes: Does Oct-TyrR exhibit biased signaling depending on which ligand activates it (tyramine vs. octopamine), and how does this impact downstream physiological responses?

  • Neuronal Circuit Integration: How do Oct-TyrR-expressing neurons integrate into broader neural circuits controlling behaviors such as reproduction, feeding, and stress responses?

  • Developmental Regulation: How is Oct-TyrR expression regulated throughout development, and does it play specific roles during critical developmental windows?

  • Evolutionary Trajectory: What evolutionary pressures drove the diversification of octopamine and tyramine receptors in insects, and why have some receptor subtypes like Oct-TyrR been conserved across species while others appear more species-specific?

  • Regulatory Mechanisms: What transcriptional, post-transcriptional, and post-translational mechanisms regulate Oct-TyrR expression and function in different tissues and physiological states?

  • Therapeutic Potential: Can selective Oct-TyrR modulators be developed that target pest insect species while sparing beneficial insects, and what structural features would enable such selectivity?

  • Interplay with Other Neuromodulatory Systems: How does Oct-TyrR signaling interact with other neuromodulatory systems (dopamine, serotonin, neuropeptides) to fine-tune physiological responses and behaviors?

  • Role in Neuroplasticity: Does Oct-TyrR participate in experience-dependent plasticity in the insect nervous system, similar to the roles of adrenergic receptors in vertebrate learning and memory?

  • Environmental Regulation: How do environmental factors like stress, nutrition, or social context influence Oct-TyrR expression and signaling, and what are the consequences for insect behavior and physiology?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.