Recombinant Drosophila melanogaster Uncharacterized protein CG1161 (CG1161)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
CG1161; Uncharacterized protein CG1161
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG1161
Target Protein Sequence
MAHKRLFVYAVLLVICYLVGVTWAETAAQTFPAIGTNSNNNSNAQPAPVPAPAAPAAAAP LAKQVSAPTAAPPAKVIGQPVLAAPGKNSSNSSSTTECVCAGALLPRLDANGKELPICAE CKCSHVARNTTLIKVVVIIVIWIISILVIYMLFLMCLDPLLNKRVKANYQEHTNEDDEPT PPLPAVNNQELSARANVLNRVGHQQDKWKRQVREQRRHIYDRHTMLN
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG1161

UniGene: Dm.4886

Protein Families
TMEM9 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should recombinant CG1161 protein be stored and handled for optimal stability?

For optimal stability of recombinant CG1161:

  • Store at -20°C for regular use

  • For extended storage, maintain at -20°C or -80°C

  • Working aliquots can be kept at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

  • The protein is typically provided in a Tris-based buffer with 50% glycerol optimized for stability

What systematic approaches can researchers use to gather information about uncharacterized proteins like CG1161?

A systematic information-mining workflow for uncharacterized Drosophila proteins includes:

  • Expression analysis: Utilize large-scale transcriptomics datasets from:

    • modENCODE project (bulk RNAseq)

    • FlyAtlas 2 (tissue-specific expression)

    • Fly Cell Atlas (FCA; single-cell RNAseq)

  • Localization data: Examine RNA localization patterns through:

    • Berkeley Drosophila Genome Project's (BDGP) in situ library

    • Fly-FISH project for subcellular localization

  • Comparative genomics: Search for:

    • Paralogs within Drosophila

    • Orthologs in other species

    • Human orthologs with potential disease associations

  • Protein interactions: Analyze data from:

    • BioPlex databases

    • Affinity purification mass spectrometry (AP-MS) experiments

This comprehensive approach helps formulate testable hypotheses about protein function before experimental work begins .

What genetic approaches are most effective for studying the function of CG1161 in vivo?

Several genetic approaches can be employed to characterize CG1161:

  • GAL4/UAS system: For tissue-specific manipulation:

    • Use tissue-specific GAL4 drivers to express UAS-CG1161-RNAi

    • Employ UAS-CG1161 for overexpression studies

    • Combine with temperature-sensitive GAL80 (GAL80^ts) for temporal control

  • CRISPR-Cas9 editing: For precise genetic manipulation:

    • Generate null mutations

    • Create tagged versions for protein localization

    • Introduce specific mutations to test structure-function relationships

  • Conditional expression systems:

    • GeneSwitch system using RU486 administration

    • Q-system using quinic acid for reversible transgene expression

  • RNAi effectiveness assessment:

    • In studies of uncharacterized Drosophila genes, RNAi effectiveness varied by target and GAL4 driver

    • For example, similar experiments showed knockdown effects ranging from 5.00%-99.96% variation among individuals

    • Multiple independent RNAi lines should be tested to confirm results

What phenotypic assays should be prioritized when characterizing CG1161?

Based on research practices with uncharacterized Drosophila proteins, researchers should consider these phenotypic assays:

  • Behavioral assessments:

    • Mating behavior assays (proportion of successful matings in fixed time)

    • High-throughput behavioral screening using systems like coccinella

    • Feeding behavior analysis, particularly after genetic manipulation

  • Developmental analyses:

    • Survival rates under various conditions

    • Developmental timing across life stages

    • Tissue-specific morphological effects

  • Metabolic phenotyping:

    • Lipid metabolism changes (particularly relevant as auxin exposure affects lipid metabolism in Drosophila)

    • Energy utilization measurements

    • Stress response quantification

  • Neurological assessment:

    • If expressed in neural tissues, examine potential neurodegeneration phenotypes

    • Sensory response testing

Recent studies found significant genetic variation for mating success when DGRP males and females were tested, with broad sense heritability of H^2 = 0.48 for females and H^2 = 0.44 for males, demonstrating the sensitivity of such assays .

What mass spectrometry-based methods are recommended for validating and characterizing CG1161?

For comprehensive mass spectrometry analysis of CG1161:

  • Sample preparation:

    • Cell culture and sample fractionation to ensure adequate separation

    • Two-dimensional gel electrophoresis (2-DE) with immobilized pH gradients (IPGs)

  • MS workflow:

    • Tryptic digestion of gel spots/bands

    • LC-MS/MS analysis with:

      • Precursor mass tolerance of 10 ppm

      • Fragment mass tolerance of 0.5 Da

      • Fixed modification: carbamidomethylation of cysteine

      • Variable modification: oxidation of methionine

  • Validation criteria:

    • FDR cutoff of 1% for peptides and proteins

    • Minimum of two detected peptides (at least one unique)

    • Comparison against BioPlex databases

This approach has been successfully used to characterize previously uncharacterized proteins in systematic studies .

How can protein-protein interaction studies aid in determining CG1161 function?

Protein-protein interaction studies provide valuable functional insights:

  • AP-MS experiments:

    • Construct HA-FLAG-tagged CG1161 as bait

    • Identify prey proteins through mass spectrometry

    • Compare with existing BioPlex 2.0 database results

  • Analysis approach:

    • Examine interaction networks for functional enrichment

    • Identify protein complexes containing CG1161

    • Cross-reference with known biological pathways

  • Validation methods:

    • Co-immunoprecipitation confirmation of key interactions

    • Proximity labeling approaches (BioID, APEX)

    • Functional studies of identified interactors

Previous studies with uncharacterized proteins showed that 37.6% of genes lack information about alternative splicing, so capturing all possible protein isoforms is critical .

How might CG1161 be involved in interorgan communication in Drosophila?

To investigate CG1161's potential role in interorgan communication:

  • Tissue expression mapping:

    • Determine expression patterns across tissues using tissue-specific Gal4 drivers

    • Create reporter constructs to visualize expression in vivo

    • Compare with known signaling pathway components

  • Functional testing:

    • Tissue-specific RNAi knockdown followed by whole-organism phenotyping

    • Examine effects on:

      • Stem cell proliferation and maintenance

      • Metabolic regulation of nutrition and energy

      • Response to environmental stimuli

      • Potential hormone biosynthesis pathways

  • Interorgan signaling assays:

    • Ex vivo co-culture experiments with tissues expressing/lacking CG1161

    • Hemolymph transfer experiments

    • Metabolomic analysis of secreted factors

Niwa's research group has established methodologies for studying interorgan communication that could be adapted to investigate CG1161's role in homeostasis and transistasis .

What approaches would best position CG1161 within genetic and evolutionary frameworks?

To place CG1161 in genetic and evolutionary contexts:

  • Epistasis studies:

    • Create double mutants with genes in hypothesized pathways

    • Quantify synergistic or antagonistic interaction effects

    • Test for genetic rescue in various backgrounds

  • Evolutionary analysis:

    • Compare CG1161 sequence across Drosophila species

    • Calculate selection pressures (dN/dS ratios)

    • Identify conserved domains and species-specific adaptations

  • Population genetic variation:

    • Analyze CG1161 variants across DGRP lines

    • Link polymorphisms to phenotypic differences

    • Employ genome-wide association studies when phenotypes are established

Studies of uncharacterized genes have revealed important insights into evolutionary processes; for example, research has shown significant variation in recombination rates between populations (3.44 cM/Mb in West African vs. 2.06 cM/Mb in European D. melanogaster) .

What are the most common pitfalls when studying uncharacterized proteins, and how can researchers avoid them?

Common challenges when studying proteins like CG1161 include:

  • Limited baseline information:

    • Solution: Thoroughly mine existing databases before experimentation

    • Cross-reference multiple information sources (FlyBase, Alliance for Genome Resources, etc.)

  • Functional redundancy:

    • Challenge: Knockdown may show no phenotype due to compensation

    • Solution: Consider double/triple knockdowns of related genes

    • Examine subtle phenotypes under various conditions

  • Off-target effects in RNAi:

    • Challenge: RNAi can have unintended targets

    • Solution: Use multiple independent RNAi lines

    • Validate with CRISPR-generated mutants

    • Use different GAL4 drivers with varying expression strengths

  • Protein expression challenges:

    • Challenge: Recombinant proteins may not fold properly

    • Solution: Test multiple expression systems (E. coli, yeast, baculovirus, mammalian)

    • Consider tag position and type carefully

How should researchers approach contradictory data when characterizing CG1161?

When facing contradictory results:

  • Systematic troubleshooting:

    • Verify reagent quality and specificity

    • Check for genetic background effects

    • Examine environmental variables (temperature, diet, etc.)

  • Multi-method validation:

    • Confirm key findings with orthogonal techniques

    • Compare in vivo and in vitro results

    • Reconcile differences between overexpression and knockdown phenotypes

  • Contextual interpretation:

    • Consider tissue-specific effects

    • Examine developmental timing

    • Evaluate gene dosage effects

  • Literature precedent:

    • Review how contradictions in other uncharacterized proteins were resolved

    • Consider pleiotropic effects observed in similar proteins

Research on uncharacterized Drosophila genes has shown that even established techniques can yield different results based on context - for example, using different GAL4 drivers with the same UAS-RNAi construct produced opposite effects on mating success .

What databases and tools are most valuable for investigating CG1161?

Key databases and tools for CG1161 research:

Database/ToolPurposeURL/Access
FlyBasePrimary Drosophila genomic databaseflybase.org
Alliance for Genome ResourcesCross-species gene informationalliancegenome.org
modENCODETranscriptomics datamodencode.org
FlyAtlas 2Tissue-specific expressionflyatlas.gla.ac.uk
Fly Cell AtlasSingle-cell transcriptomicsflycellatlas.org
BioPlexProtein-protein interaction databioplex.hms.harvard.edu
BDGP in situRNA localization patternsinsitu.fruitfly.org
DIOPTOrtholog predictionsflyrnai.org/diopt
DPiMDrosophila Protein interaction Mapflybase.org/reports/FBrf0218395

These resources have proven essential for characterizing previously uncharacterized Drosophila proteins .

What reagents are available for studying CG1161, and how should researchers select among them?

Available reagents for CG1161 research:

  • Recombinant proteins:

    • Full-length protein (1-227 amino acids)

    • Available from multiple sources with different expression systems:

      • E. coli-expressed (His-tagged)

      • Yeast-expressed systems

      • Baculovirus-expressed protein

      • Mammalian cell-expressed protein

  • Antibodies:

    • Commercial antibodies against CG1161 (Q9VNA4)

    • Consider validation status before selection

  • Genetic reagents:

    • RNAi lines targeting CG1161

    • Consider multiple independent lines

    • Check for off-target predictions

  • Selection criteria:

    • For structural studies: Higher purity E. coli or mammalian expressed proteins

    • For functional studies: Properly folded protein with confirmed activity

    • For in vivo studies: Validated genetic tools with minimal off-target effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.