Recombinant Drosophila melanogaster Uncharacterized protein CG7816 (CG7816)

Shipped with Ice Packs
In Stock

Description

Production and Purification

CG7816 is produced via recombinant DNA technology in E. coli systems. Key steps include:

  1. Cloning: Full-length CG7816 cDNA (1–355 aa) inserted into expression vectors.

  2. Induction: Protein expression driven by IPTG-inducible promoters.

  3. Purification: Affinity chromatography using nickel-NTA resins targeting the His tag .

Commercial availability includes:

  • Research-grade protein: Lyophilized powder (Creative BioMart, Cat.# RFL13030DF) .

  • ELISA kits: Quantification tools optimized for CG7816 detection (American Sci, Cat.# CSB-CF893248DLU) .

Functional and Interaction Insights

While CG7816’s biological role remains uncharacterized, bioinformatic analyses suggest:

  • Hypothetical function: Homology to zinc transporters (ZIP family) implies potential roles in metal ion homeostasis .

  • Protein-protein interactions (PPIs):

    • Integrated into the Drosophila reference interactome (DroRI), which catalogs 17,232 PPIs .

    • Yeast two-hybrid screens identified interaction partners, though specifics remain unpublished .

Research Applications

CG7816 is primarily used in:

  • Structural studies: Analyzing transmembrane topology via cryo-EM or X-ray crystallography.

  • Interaction mapping: As bait in high-throughput Y2H screens to identify novel PPIs .

  • Antibody development: Immunogens for raising monoclonal/polyclonal antibodies .

Challenges and Future Directions

Despite advances:

  • Functional ambiguity: 60% of Drosophila genes lack detailed annotations, including CG7816 .

  • Research gaps: No in vivo validation (e.g., knockout phenotypes) or pathway associations reported.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we are open to developing specific tags if you have a preference. Please communicate your desired tag type to us.
Synonyms
Zip99C; CG7816; Zinc transporter ZIP13 homolog; Zinc/iron regulated transporter-related protein 99C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Zip99C
Target Protein Sequence
MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTE EKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLWV LSGILIFTIVEKIFSGYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIE DVGKVCFLREQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILAT FAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMTMLFEH
Uniprot No.

Target Background

Function
This protein is involved in zinc transport and homeostasis.
Database Links

KEGG: dme:Dmel_CG7816

STRING: 7227.FBpp0088864

UniGene: Dm.7928

Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=Also detected on intracellular membranes.

Q&A

How is recombinant CG7816 protein typically expressed and purified?

The recombinant expression of CG7816 protein typically employs E. coli as the expression host with an N-terminal His-tag to facilitate purification . The standard protocol involves:

  • Cloning the full-length CG7816 coding sequence (positions 1-355) into an appropriate expression vector

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the His-tagged protein using affinity chromatography

  • Performing quality control via SDS-PAGE to ensure >90% purity

  • Lyophilizing the purified protein in a Tris/PBS-based buffer with 6% trehalose at pH 8.0

For experimental use, researchers should reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol (recommended final concentration 50%) for long-term storage at -20°C/-80°C .

What experimental designs are most effective for studying the metal transport function of CG7816/Zip99C?

Effective experimental designs for studying CG7816/Zip99C metal transport function should incorporate both in vivo and in vitro approaches. A comprehensive experimental design would include:

Experimental ApproachTechniquesMeasurementsControl Considerations
Metal content quantificationInductively coupled plasma-mass spectrometry (ICP-MS)Metal levels in whole larvae, isolated tissues, and subcellular fractionsWild-type vs. CG7816 mutant flies; tissue-specific knockdowns
Subcellular localizationOrganelle fractionation, immunofluorescenceProtein distribution across cellular compartmentsCo-localization with known compartment markers
Transport activityRadioactive metal uptake assaysMetal import/export kineticsSpecific inhibitors, temperature-dependent controls
Phenotypic analysisLongevity assays, developmental studiesLifespan, developmental timingControlled diet, temperature, and humidity conditions

When designing such experiments, researchers should define clear independent variables (e.g., CG7816 expression levels) and dependent variables (e.g., metal content in specific compartments), while controlling for extraneous variables like environmental conditions and genetic background .

How can researchers differentiate between zinc and iron transport roles of CG7816/Zip99C?

Distinguishing between zinc and iron transport functions of CG7816/Zip99C requires carefully designed experiments that can selectively measure each metal's movement. Research suggests that despite being initially classified as a zinc transporter, CG7816/Zip99C appears to function primarily in iron efflux into the secretory pathway .

To differentiate these functions, researchers should:

  • Perform metal-specific competition assays to determine transport specificity

  • Conduct ICP-MS analysis of ER/Golgi fractions in wild-type versus CG7816 mutant flies

  • Implement rescue experiments with metal-specific chelators

  • Analyze phenotypes under conditions of iron or zinc deficiency/excess

  • Examine protein function in heterologous expression systems with controlled metal availability

The key challenge in these experiments is maintaining metal specificity and avoiding cross-contamination between different metal pools within biological samples.

What methods are recommended for quantifying metal content in subcellular compartments?

Accurate metal quantification in subcellular compartments is critical for understanding CG7816 function. The recommended methodology involves:

  • Isolation of specific organelles through differential centrifugation or immunoprecipitation

  • Purification of ER/Golgi fractions following established protocols (e.g., Graham, 2001)

  • Protein concentration determination using standard methods (e.g., BCA assay)

  • Metal content analysis using ICP-MS with approximately 1.4 mg protein per sample

  • Calculation of metal concentration relative to protein content

For ER/Golgi metal content specifically, researchers should purify Drosophila ER/Golgi fractions following established subcellular fractionation techniques and normalize metal content to protein concentration before ICP-MS analysis .

How do mutations in CG7816 affect Drosophila lifespan and development?

CG7816/Zip99C mutations can significantly impact Drosophila lifespan and development due to disruptions in metal homeostasis. To study these effects, researchers should implement longevity assays following this methodology:

  • Collect 3-day-old adult females

  • Place 20 flies in each food vial maintained at 25°C with 60% humidity under a 12-hour light-dark cycle

  • Change food vials every 2 days and count deceased flies

  • Conduct at least 10 parallel group tests for each genotype

  • Repeat experiments at least three times

  • Calculate median survival and compare between genotypes

Percentage increases in lifespan should be based on comparing the median survivals to the controls. This approach provides robust data on how CG7816 function affects organism-level phenotypes related to metal transport disruption.

What are the best practices for visualizing CG7816 localization in cells?

Visualizing CG7816 localization requires techniques that can detect the protein in native cellular environments while preserving spatial relationships with other cellular components. Recommended approaches include:

  • Immunofluorescence microscopy: Using specific antibodies against CG7816 or epitope tags

  • Fluorescent protein fusions: Creating GFP or other fluorescent protein fusions that preserve protein function

  • Co-localization studies: Combining CG7816 detection with markers for specific organelles (ER, Golgi, lysosomes)

  • Super-resolution microscopy: Employing techniques like STORM or PALM for detailed subcellular localization

  • Live-cell imaging: Monitoring protein dynamics in real-time using appropriate labeling techniques

For optimal results, researchers should verify that tagging or antibody detection does not interfere with protein function through complementary functional assays.

How can researchers design experiments to study CG7816 interactions with other proteins?

Investigating CG7816 protein-protein interactions requires a systematic approach combining multiple techniques:

TechniqueApplicationAdvantagesLimitations
Yeast two-hybridInitial screening for interactorsHigh-throughput capabilityPotential false positives
Co-immunoprecipitationValidation of interactions in native contextPreserves physiological conditionsLimited to stable interactions
Proximity labeling (BioID/APEX)Identification of transient interactionsDetects weak/transient interactionsRequires genetic modification
FRET/BRETReal-time interaction dynamicsCan measure interaction kineticsComplex implementation
Crosslinking coupled with mass spectrometryDetailed interaction sitesProvides structural informationTechnical complexity

When designing experiments to study these interactions, researchers should:

  • Begin with in silico predictions based on sequence analysis

  • Perform initial screening using high-throughput methods

  • Validate candidate interactions using multiple orthogonal techniques

  • Characterize the functional significance of validated interactions

  • Map interaction domains through targeted mutagenesis

This systematic approach helps build a comprehensive understanding of CG7816's functional interactome.

What are common challenges when working with recombinant CG7816 protein?

Working with recombinant CG7816 presents several technical challenges that researchers should anticipate:

  • Protein stability: The protein may undergo degradation during storage. Aliquoting and avoiding repeated freeze-thaw cycles is critical for maintaining activity .

  • Solubility issues: As a membrane protein, CG7816 may have limited solubility. Addition of appropriate detergents or membrane-mimetic systems may be necessary.

  • Functional verification: Since the protein is involved in metal transport, verifying its functionality requires specialized metal transport assays.

  • Structural studies: Membrane proteins present unique challenges for structural characterization, requiring specialized approaches like cryo-EM or crystallography with appropriate detergents.

  • Metal contamination: Experiments investigating metal transport are susceptible to environmental metal contamination, requiring rigorous controls and metal-free reagents.

To address these challenges, researchers should implement stringent quality control, optimize buffer conditions, and validate protein activity before conducting detailed functional studies.

How can researchers address data contradictions in CG7816 functional studies?

When faced with contradictory data regarding CG7816 function, researchers should implement a systematic approach to resolve discrepancies:

  • Evaluate methodological differences: Compare experimental conditions, genetic backgrounds, and analytical techniques across studies.

  • Consider metal specificity: The protein was initially classified as a zinc transporter but appears to function in iron transport . This dual role may explain some contradictions.

  • Assess temporal and spatial constraints: CG7816 function may vary across developmental stages or tissues.

  • Design definitive experiments: Create experiments specifically designed to test competing hypotheses with appropriate controls.

  • Use complementary approaches: Combine genetics, biochemistry, and cell biology techniques to provide multiple lines of evidence.

  • Control environmental variables: Since metal transport studies are sensitive to environmental conditions, standardizing experimental conditions is crucial .

Resolving contradictions often requires presenting data in well-designed tables and figures that clearly illustrate experimental findings and their statistical significance .

What are promising applications of CG7816 research in understanding human disease?

CG7816 (Zip99C) is the Drosophila homolog of human ZIP13, which has been implicated in connective tissue disorders. Research on CG7816 may provide insights into:

  • Spondylocheirodysplasia Ehlers-Danlos syndrome-like: Caused by mutations in human SLC39A13 (ZIP13)

  • Metal homeostasis disorders: Conditions resulting from disrupted zinc or iron metabolism

  • Secretory pathway dysfunction: Diseases involving impaired protein trafficking through the ER/Golgi

  • Aging and longevity: Based on the effects of CG7816 mutations on Drosophila lifespan

  • Neurodegenerative diseases: Many of which involve metal dyshomeostasis

This research highlights the value of Drosophila as a model organism for studying conserved cellular processes relevant to human health and disease.

How can advanced 'omics' approaches enhance our understanding of CG7816 function?

Integrating modern 'omics' technologies can provide comprehensive insights into CG7816 function:

  • Transcriptomics: RNA-seq analysis of CG7816 mutants can reveal downstream gene expression changes

  • Proteomics: Quantitative proteomics can identify changes in the cellular proteome in response to CG7816 dysfunction

  • Metallomics: Specialized techniques to map the distribution of metals across tissues and subcellular compartments

  • Metabolomics: Analysis of metabolic changes resulting from altered metal homeostasis

  • Structural genomics: Techniques to determine protein structure and inform function

These approaches, combined with classical genetic and biochemical techniques, can provide a systems-level understanding of CG7816's role in cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.