Recombinant Drosophila melanogaster Vacuolar ATPase assembly integral membrane protein VMA21 (CG5969)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Drosophila melanogaster Vacuolar ATPase assembly integral membrane protein VMA21 (CG5969) is a recombinant protein derived from the fruit fly gene CG5969. It serves as a critical chaperone for the assembly of the vacuolar ATPase (V-ATPase) complex, a proton pump essential for acidifying intracellular compartments like lysosomes and vacuoles. In Drosophila, this protein facilitates the proper assembly of the V₀ domain of the V-ATPase in the endoplasmic reticulum (ER), ensuring functional proton transport .

Production Systems

The recombinant protein is expressed in multiple host systems, including E. coli, yeast, baculovirus-infected cells, and mammalian cells, with varying yields and purification methods .

Host SystemPuritySourceKey Applications
E. coli>85% (SDS-PAGE) Structural studies, ELISA assays
Baculovirus>85% (SDS-PAGE) Functional assays, protein folding
Mammalian cells>85% (SDS-PAGE) Post-translational modification studies

Mechanism of Action

VMA21 acts as a chaperone for the V₀ domain of the V-ATPase, ensuring its proper folding and stability during ER transport. In D. melanogaster, this process is critical for:

  • Proton Pump Activity: Enables acidification of lysosomes and vacuoles, essential for protein degradation and nutrient uptake .

  • Organelle Biogenesis: Defects in VMA21 lead to misfolded V₀ subunits, triggering proteasomal degradation and impaired V-ATPase function .

Evolutionary Conservation

The CG5969 gene is orthologous to human VMA21 and yeast VMA21p, sharing conserved motifs like the dCLEAR regulatory element, which governs transcriptional regulation in Drosophila .

Key Studies in Drosophila and Other Models

Study FocusFindingsImplications
V-ATPase AssemblyDeletion of CG5969 disrupts V₀ domain assembly, reducing lysosomal acidity .Links to lysosomal storage disorders and autophagy.
Muscle PathologyVMA21-deficient zebrafish exhibit autophagic vacuoles and muscle weakness, mirroring human X-linked myopathy with excessive autophagy (XMEA) .Validates Drosophila as a model for studying V-ATPase-related diseases.
Cancer BiologyElevated VMA21 expression correlates with favorable prognosis in colorectal cancer, suggesting tumor-suppressive roles .Potential therapeutic target in oncology.

Human Disease Connections

  • XMEA: Mutations in human VMA21 cause lysosomal neutralization, triggering excessive autophagy and muscle vacuolation .

  • Lymphoma: VMA21 mutations in follicular lymphoma (FL) cells induce autolysosome accumulation, creating dependencies on autophagy inhibitors .

Experimental Uses

  • ELISA Assays: Recombinant VMA21 is used to detect anti-VMA21 antibodies in patient sera .

  • Functional Assays: Studies in HEK293T cells reveal that mutant VMA21 variants (e.g., p.93X) disrupt lysosomal acidification and autophagic flux .

  • Therapeutic Screening: Zebrafish models of vma21 deficiency are employed to test autophagy-modulating drugs like edaravone and LY294002 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we can accommodate specific format requests. Please specify your preference in the order notes and we will fulfill your demand whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CG5969; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG5969
Target Protein Sequence
MSTKNKKAAGGNGVAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links

KEGG: dme:Dmel_CG5969

STRING: 7227.FBpp0077856

UniGene: Dm.21636

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its primary function in cellular biology?

VMA21 is an essential assembly factor for the V0 domain of vacuolar ATPase (V-ATPase), a multi-subunit enzyme complex responsible for acidification of intracellular compartments. In Drosophila melanogaster, the VMA21 protein (encoded by gene CG5969) functions as an integral membrane chaperone that assists in the assembly of the V0 domain within the endoplasmic reticulum before its transport to target membranes. This protein ensures proper folding and assembly of V-ATPase components, which is crucial for maintaining optimal proton translocation and lysosomal acidification . The functional importance of VMA21 is highlighted by studies in various organisms showing that its deficiency can lead to impaired lysosomal-mediated degradation and blocked autophagy .

How conserved is VMA21 across different species?

VMA21 demonstrates remarkable evolutionary conservation across multiple species, from fungi to mammals. The protein has been identified and characterized in diverse organisms including Saccharomyces cerevisiae, Drosophila species (melanogaster, yakuba, sechellia), Danio rerio, and various fungi such as Cryptococcus neoformans, Magnaporthe oryzae, and Aspergillus species . This high degree of conservation suggests the fundamental importance of VMA21 in cellular physiology across eukaryotic organisms. When comparing VMA21 proteins from different Drosophila species, such as D. melanogaster, D. yakuba (GE19686), and D. sechellia (GM22297), researchers have noted significant sequence homology, particularly in functional domains associated with V-ATPase assembly .

What are the structural characteristics of Drosophila melanogaster VMA21?

Drosophila melanogaster VMA21 is a small integral membrane protein characterized by multiple membrane-spanning domains. Its structural features include:

  • Two predicted transmembrane domains

  • A conserved glutamate residue essential for interaction with V-ATPase subunits

  • An endoplasmic reticulum retention signal that ensures proper localization during V-ATPase assembly

  • Structural motifs that facilitate protein-protein interactions with V0 domain components

Understanding these structural elements is crucial for researchers designing experiments to investigate VMA21 function or developing targeted mutations for functional studies.

How does VMA21 specifically contribute to V-ATPase assembly in Drosophila models?

The assembly of functional V-ATPase complexes in Drosophila involves multiple coordinated steps with VMA21 playing a pivotal role specifically in V0 domain assembly. VMA21 functions by binding to nascent V0 subunits in the ER, preventing premature degradation and facilitating proper folding. Studies suggest that VMA21 may coordinate with other assembly factors like TMEM199, CCDC115, ATP6AP1, and ATP6AP2, as evidenced by correlation analyses showing significant associations between VMA21 and ATP6AP1 (r = 0.56, P < 0.001) and ATP6AP2 (r = 0.52, P < 0.001) in human tissues . In Drosophila, genetic approaches using RNAi knockdown or CRISPR/Cas9-mediated mutations can reveal specific assembly defects and subsequent cellular consequences when VMA21 function is compromised.

What phenotypes emerge from VMA21 dysfunction in Drosophila melanogaster?

VMA21 dysfunction in Drosophila melanogaster can manifest as multiple cellular and organismal phenotypes due to compromised V-ATPase function, including:

  • Defective autophagy and endolysosomal trafficking

  • Impaired nutrient sensing and signaling pathways

  • Developmental abnormalities, particularly in tissues with high secretory activity

  • Altered neuronal function due to synaptic vesicle acidification defects

  • Changes in cellular pH homeostasis and ion balance

These phenotypes can provide valuable insights for researchers studying fundamental cellular processes and potential disease mechanisms. The severity of these phenotypes may vary depending on whether VMA21 is completely knocked out or partially inhibited.

How can researchers effectively modulate VMA21 expression in Drosophila experimental systems?

Researchers can employ several strategies to modulate VMA21 expression in Drosophila experimental systems:

  • GAL4-UAS System: Utilizing the GAL4-UAS system for tissue-specific overexpression or knockdown of VMA21

  • CRISPR/Cas9 Gene Editing: Creating precise mutations or complete gene knockouts

  • Inducible Expression Systems: Temporal control of VMA21 expression using temperature-sensitive or drug-inducible promoters

  • Transgenic Rescue Experiments: Expressing wild-type or mutant VMA21 in knockout backgrounds to assess functional domains

When designing these experiments, researchers should carefully consider controls and validation methods to confirm the specificity and efficiency of VMA21 modulation, as demonstrated in studies of VMA21 in other systems where both overexpression and knockdown approaches revealed significant effects on cellular function .

What expression systems are optimal for producing recombinant Drosophila melanogaster VMA21?

Several expression systems can be utilized for producing recombinant Drosophila melanogaster VMA21, each with advantages for specific research applications:

Expression SystemAdvantagesLimitationsTypical YieldBest For
E. coliCost-effective, rapid expression, high yieldsMay lack proper post-translational modifications, membrane protein folding challenges5-10 mg/LStructural studies, antibody production
YeastEukaryotic processing, suitable for membrane proteinsLonger production time than bacterial systems2-5 mg/LFunctional studies requiring proper folding
BaculovirusInsect-derived system, excellent for Drosophila proteinsMore complex setup, higher cost1-5 mg/LNative-like protein with proper modifications
Mammalian CellAdvanced post-translational modificationsHighest cost, lower yields0.5-2 mg/LComplex functional assays, interaction studies

When selecting an expression system, researchers should consider the downstream applications. For example, structural studies may prioritize quantity, while functional assays may require the most native-like protein conformation. Most commercial recombinant VMA21 proteins achieve greater than or equal to 85% purity as determined by SDS-PAGE regardless of the expression system used .

What purification strategies yield the highest purity of recombinant VMA21?

Purification of recombinant VMA21 presents challenges due to its membrane-associated nature. Effective purification strategies include:

  • Detergent Solubilization: Selection of appropriate detergents (e.g., DDM, LMNG) is critical for maintaining protein structure during extraction from membranes

  • Affinity Chromatography: Utilizing tags such as His6, FLAG, or GST for initial capture

  • Size Exclusion Chromatography: For separating monomeric VMA21 from aggregates and removing detergent micelles

  • Ion Exchange Chromatography: As a polishing step to achieve higher purity

A typical purification workflow might achieve ≥85% purity as standard for commercial preparations , but researchers requiring ultra-pure protein for crystallography or other structural analyses should implement additional purification steps.

How can researchers assess VMA21 function in relation to V-ATPase activity?

Assessment of VMA21 function requires multi-faceted approaches that examine both its direct role in V-ATPase assembly and the consequent cellular impacts:

  • V-ATPase Assembly Assays:

    • Co-immunoprecipitation to detect interactions between VMA21 and V-ATPase subunits

    • Blue Native PAGE to visualize assembled V-ATPase complexes

    • Subcellular fractionation to track V-ATPase components in various cellular compartments

  • V-ATPase Activity Measurements:

    • Lysosomal pH quantification using pH-sensitive fluorescent probes

    • ATP hydrolysis assays using isolated vesicles

    • Proton translocation assays using fluorescent quenching methods

  • Cellular Phenotype Analysis:

    • Autophagy flux monitoring using LC3 conversion assays

    • Endocytosis and trafficking assays using fluorescent tracers

    • Cell growth and viability assessments under various stress conditions

Research on human cancer cells demonstrated that VMA21 modulation significantly affected cell growth in colony formation assays and in xenograft models, highlighting the functional importance of this protein in cellular homeostasis .

What is the potential significance of VMA21 in disease models?

VMA21 dysfunction has implications for various disease models due to the fundamental importance of V-ATPase in cellular physiology:

  • Neurodegenerative Diseases: Dysregulation of lysosomal function and autophagy are hallmarks of many neurodegenerative conditions

  • Cancer Biology: Studies have shown that VMA21 has tumor suppressor properties in colorectal cancer, with high VMA21 expression associated with higher differentiation grade and longer disease-specific survival

  • Metabolic Disorders: V-ATPase plays critical roles in nutrient sensing and metabolic regulation

  • Developmental Abnormalities: Given the importance of proper pH regulation during development

In colorectal cancer studies, ectopic expression of VMA21 significantly reduced the growth of cancer cells both in vitro and in vivo, whereas knockdown promoted tumor development . This suggests that VMA21 modulation could have therapeutic potential in certain disease contexts.

How can researchers investigate VMA21 interactions with other V-ATPase assembly factors?

To investigate interactions between VMA21 and other V-ATPase assembly factors, researchers can employ:

  • Yeast Two-Hybrid Screening: To identify potential protein-protein interactions

  • Proximity Labeling Methods: Such as BioID or APEX to identify proteins in close proximity to VMA21 in living cells

  • Co-expression Analysis: Examining correlation patterns between VMA21 and other assembly factors, as demonstrated in TCGA data showing significant correlations between VMA21 and ATP6AP1/ATP6AP2

  • Genetic Interaction Studies: Using double mutant/knockdown approaches to reveal functional relationships

These approaches can reveal how VMA21 coordinates with other factors like TMEM199, CCDC115, ATP6AP1, and ATP6AP2 to ensure proper V-ATPase assembly.

What are common challenges in working with recombinant VMA21 and how can they be addressed?

Researchers working with recombinant VMA21 often encounter several challenges:

ChallengeCauseSolution
Low expression yieldMembrane protein toxicity to host cellsUse lower induction temperatures, specialized host strains, or fusion partners to enhance solubility
Protein aggregationImproper folding, detergent incompatibilityScreen multiple detergents, include stabilizing agents, optimize buffer conditions
Loss of activityDenaturation during purificationMaintain constant detergent concentration, include glycerol or specific lipids in buffers
Inconsistent purityContaminant proteins with similar propertiesImplement tandem purification strategies with orthogonal techniques
Limited stabilityInherent membrane protein propertiesStore in appropriate detergent/lipid environments, consider protein engineering approaches

When troubleshooting, researchers should systematically test variables and maintain careful documentation of conditions that yield improvements in protein quality or quantity. Quality assessment using techniques like circular dichroism can help ensure the recombinant protein maintains native-like secondary structure.

How can researchers validate antibodies for studying Drosophila melanogaster VMA21?

Proper antibody validation is critical for reliable results when studying VMA21. A comprehensive validation approach includes:

  • Western Blot Analysis:

    • Testing antibody against wild-type samples versus VMA21 knockout/knockdown controls

    • Confirming specific band at expected molecular weight

    • Evaluating cross-reactivity with related proteins

  • Immunofluorescence Specificity:

    • Comparing staining patterns in control versus VMA21-depleted samples

    • Co-localization with known markers of VMA21's expected subcellular location

    • Secondary antibody-only controls to assess background

  • Validation in Multiple Applications:

    • Testing antibody performance in different applications (WB, IF, IP, IHC)

    • Determining optimal antibody concentration for each application

  • Cross-Species Reactivity Assessment:

    • Evaluating whether antibodies against VMA21 from other species recognize Drosophila VMA21

    • Determining epitope conservation across species

These validation steps ensure that experimental observations truly reflect VMA21 biology rather than antibody artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.