Recombinant Drosophila melanogaster Zinc finger protein-like 1 homolog (CG5382)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we will prioritize your specified tag type if provided.
Synonyms
CG5382; Zinc finger protein-like 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG5382
Target Protein Sequence
MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTL EQGDCVRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACSVEIFPNANLVSPVADALKS FLSQVNWGRNGLGLALLSEEQSSSLKAIKPKVASQAAVSNMTKVHHIHSGGERERTKPNG HDAVSPHSVLLMDAFNPPSAGDYASSRRPLLPRQSPIGGTDRDDNKYQRRTPAELFSRWT RRFYAPSSRPPWRRTWFLVTAGILAFVLFVYLMAWLGRGGSDAVDEGWNNPNPQPNHYE
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG5382

STRING: 7227.FBpp0083630

UniGene: Dm.1277

Protein Families
ZFPL1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CG5382 and how is it characterized in research settings?

CG5382 is a zinc finger protein-like 1 homolog found in Drosophila melanogaster that shares significant structural and functional similarities with mammalian zinc finger proteins . The protein consists of 299 amino acids and contains critical DNA-binding zinc finger domains .

When working with recombinant versions, researchers typically use His-tagged full-length protein (amino acids 1-299) expressed in E. coli systems . The recombinant protein retains the functional characteristics of the native protein, particularly its ability to bind to specific DNA sequences in a zinc-dependent manner .

Key specifications for the recombinant protein include:

SpecificationDetails
Full NameRecombinant Full Length Drosophila Melanogaster Zinc Finger Protein-Like 1 Homolog (CG5382)
Expression SystemE. coli
SpeciesDrosophila melanogaster (Fruit fly)
TagHis
Protein LengthFull Length (1-299 amino acids)

How does CG5382 compare to its mammalian counterparts?

CG5382 shares significant homology with mammalian metal-responsive transcription factors, particularly in the DNA-binding zinc finger region where similarity reaches approximately 78% . Despite this structural conservation, functional studies reveal important differences in metal responsiveness between Drosophila and mammalian systems .

Unlike mammalian MTF-1 (Metal-responsive Transcription Factor-1), CG5382 demonstrates resistance to low pH conditions (6.0-6.5), suggesting evolutionary adaptation to different cellular environments . Additionally, the metal response profile differs significantly: while mammalian MT genes are activated most effectively by zinc and cadmium, Drosophila cells show stronger induction with cadmium and copper than with zinc .

These differences are likely attributable to divergent aspects of heavy metal metabolism rather than intrinsic properties of the transcription factors themselves, as demonstrated by cross-species transfection experiments .

What are the primary experimental applications of recombinant CG5382?

Recombinant CG5382 serves as a valuable tool for investigating metal-responsive transcriptional regulation in Drosophila systems . Key experimental applications include:

  • DNA-binding studies to characterize metal-responsive element (MRE) interactions

  • Transcriptional activation assays to assess promoter regulation

  • Comparative studies between invertebrate and vertebrate metal response pathways

  • Investigation of heavy metal detoxification mechanisms in model organisms

When designing experiments with recombinant CG5382, researchers should consider the protein's differential response to various heavy metals, with particular sensitivity to copper and cadmium rather than zinc in Drosophila cellular contexts .

How should experimental design be approached when studying CG5382's metal responsiveness?

Effective experimental design for studying CG5382's metal responsiveness requires careful consideration of multiple variables and potential confounding factors . Researchers should implement a structured approach:

  • Define measurable variables: Clearly identify independent variables (metal concentrations, exposure times) and dependent variables (transcriptional activity, DNA binding affinity) .

  • Develop specific hypotheses: Formulate testable predictions about CG5382's response to different metals based on existing literature .

  • Include appropriate controls: Incorporate negative controls (no metal exposure), positive controls (known responsive conditions), and vehicle controls to account for potential buffer effects .

  • Consider cellular context: Since metal responses differ between mammalian and Drosophila systems, experiments should be conducted in appropriate cellular backgrounds . Transfection studies in S2 cells provide the most relevant context for CG5382 function .

  • Design metal exposure treatments: To account for the unique response profile of CG5382, use concentration gradients that include higher zinc concentrations (up to 2mM may be required) and comparatively lower copper and cadmium concentrations .

When analyzing metal responsiveness data, researchers should be aware that CG5382 shows particularly strong transcriptional activation in response to copper and cadmium but requires significantly higher concentrations of zinc (≥2mM) to achieve comparable activation .

What methodological approaches are most effective for analyzing potential contradictions in CG5382 research data?

When confronted with contradictory results in CG5382 research, a systematic analytical approach is essential . Consider implementing these methodological strategies:

How can researchers effectively study the zinc finger domains of CG5382 in relation to DNA binding?

Investigating the relationship between CG5382's zinc finger domains and DNA binding requires specialized approaches that account for metal-dependent interactions . Researchers should consider:

  • DNA binding assays under varying metal conditions: Employ electrophoretic mobility shift assays (EMSAs) with purified recombinant CG5382 under different metal concentrations to quantify binding affinity to consensus MRE sequences .

  • Domain mutagenesis: Generate targeted mutations in individual zinc finger domains to assess their specific contributions to DNA binding and metal responsiveness .

  • Structure-function analysis: Compare CG5382's zinc finger domains with mammalian counterparts, focusing on the 78% conserved regions versus the divergent areas .

  • Chromatin immunoprecipitation (ChIP) approaches: Use ChIP to identify genomic binding sites in vivo under different metal exposure conditions .

  • In vitro transcription systems: Reconstitute metal-responsive transcription using purified components to dissect the molecular requirements for CG5382-mediated activation .

When designing these experiments, researchers should remember that CG5382 requires zinc for DNA binding, similar to its mammalian homologs, despite differences in transcriptional activation profiles in response to other metals .

What are the optimal experimental parameters for studying CG5382's role in heavy metal response pathways?

Optimizing experimental parameters for CG5382 functional studies requires attention to several critical factors :

  • Metal concentration ranges: Based on previous research, effective concentrations for observing CG5382-mediated responses are:

    • Zinc: 500μM-2mM (higher concentrations required than for mammalian systems)

    • Copper and cadmium: Lower concentrations are effective, as these are more potent inducers in Drosophila cells

  • Cell line selection:

    • S2 cells provide the most appropriate Drosophila cellular context

    • Transfected mammalian cells (excluding hMTF-1 which is inactive in S2 cells) can be used for comparative studies

  • Promoter constructs: Use reporters containing authentic Drosophila metallothionein promoters (Mtn and Mto) with their native MRE configurations rather than synthetic constructs .

  • Expression system optimization: When expressing recombinant CG5382, E. coli systems with His-tagging provide functional protein suitable for biochemical studies .

  • pH considerations: Unlike mammalian MTF-1, CG5382 is resistant to low pH (6.0-6.5), which may be relevant when designing buffer systems for in vitro experiments .

Researchers should note that expression of CG5382 varies across developmental stages, with increasing levels observed from embryos through larvae to pupae, and with particularly strong expression in adult fat body and gut tissues . These expression patterns should inform tissue selection for in vivo studies.

How can the "People Also Ask" approach be leveraged to identify research gaps in CG5382 studies?

The "People Also Ask" (PAA) feature provides valuable insight into related queries researchers are exploring, which can reveal understudied aspects of CG5382 biology . To leverage this approach:

  • Query expansion: Start with basic searches about CG5382 and systematically expand to related topics by clicking through PAA questions, which reveals cascading related questions .

  • Categorization of questions: Organize emergent questions into themes (e.g., structural biology, functional characterization, pathways) to identify clusters and gaps .

  • Temporal analysis: Track changes in PAA questions over time to identify emerging research interests . PAA data should be checked regularly to understand when content updates might be necessary .

  • Cross-reference with publication databases: Compare PAA questions with published literature to identify discrepancies between researcher interests and available evidence .

This approach is particularly valuable for CG5382 research given the relatively limited literature compared to mammalian zinc finger proteins, allowing researchers to identify and address knowledge gaps systematically .

What strategies can resolve data contradictions between mammalian and Drosophila MTF-1 homolog studies?

Resolving contradictory findings between mammalian and Drosophila MTF-1 homolog studies requires specialized experimental approaches :

  • Chimeric protein analysis: Construct fusion proteins containing domains from both mammalian and Drosophila MTF-1 to identify regions responsible for differential metal responses .

  • Parallel experimental designs: Simultaneously test both proteins under identical conditions to control for experimental variables .

  • Cellular context swapping: Express CG5382 in mammalian cells and mammalian MTF-1 in Drosophila cells (noting previous challenges with the latter) to distinguish protein-intrinsic from system-dependent effects .

  • Metal homeostasis characterization: Assess differences in metal transport, storage, and sensing machinery between systems that might account for differential responses .

  • Evolutionary analysis: Apply phylogenetic approaches to understand divergent features in the context of evolutionary pressure and functional adaptation .

Studies have demonstrated that when expressed in mammalian cells, dMTF-1 responds to zinc similarly to mammalian MTF-1, suggesting that species differences in metal response are due to cellular context rather than intrinsic protein differences . This highlights the importance of considering the broader cellular metal homeostasis network when interpreting seemingly contradictory data.

How should RNA expression analysis of CG5382 be designed across developmental stages?

Designing robust RNA expression analysis for CG5382 across developmental stages requires careful experimental planning :

  • Developmental timeline sampling: Based on Northern blot data showing progressive increases from embryos through larvae to pupae, establish a comprehensive sampling protocol covering all major developmental transitions .

  • Tissue-specific analysis: Include separate analysis of fat body and gut tissues, which show particularly strong expression in adults .

  • Reference gene selection: Choose appropriate reference genes with stable expression across developmental stages for accurate normalization .

  • Quantitative approaches: Implement both absolute quantification (for stage comparisons) and relative quantification (for tissue comparisons) using RT-qPCR .

  • Controls and replication: Include biological replicates (different organism cohorts) and technical replicates (multiple measurements of the same sample) to ensure reproducibility .

Northern blot analysis has demonstrated a "steady increase of dMTF-1 mRNA in embryos, larvae, and pupae relative to the mRNA for ribosomal protein L32" . This pattern should inform experimental design, particularly for time-course studies examining the relationship between CG5382 expression and developmental metal requirements.

How should researchers interpret differential metal responses between mammalian and Drosophila systems?

The differential metal responses observed between mammalian and Drosophila systems require nuanced interpretation :

  • System-specific versus protein-specific effects: Transfection experiments show that when expressed in mammalian cells, dMTF-1 responds to zinc similarly to mammalian MTF-1, despite different patterns in native Drosophila cells .

  • Evolutionary context: Differences likely reflect divergent evolutionary adaptations to different physiological metal requirements and exposure patterns .

  • Metallothionein induction patterns: In mammalian systems, MT genes are activated best by zinc and cadmium, whereas in Drosophila cells, cadmium and copper are more potent inducers than zinc .

  • pH sensitivity differences: dMTF-1's resistance to low pH (6-6.5) compared to mammalian MTF-1 suggests adaptation to different cellular environments .

  • Cross-species limitations: Human MTF-1 is transcriptionally inactive when transfected into Drosophila S2 cells, indicating fundamental compatibility issues between divergent systems .

These differences highlight the importance of selecting appropriate experimental systems when studying metal-responsive transcription factors and caution against direct extrapolation of findings between species without validation .

What critical controls should be included when designing experiments with recombinant CG5382?

Robust experimental design with recombinant CG5382 requires comprehensive controls to ensure valid interpretation :

  • Metal specificity controls:

    • Negative control: Metal chelators to confirm metal-dependency of observed effects

    • Specificity controls: Multiple metals to establish response profiles (zinc, copper, cadmium at minimum)

    • Concentration gradients: Multiple concentrations of each metal to determine dose-response relationships

  • Protein quality controls:

    • Activity assay: Verification of DNA-binding capability

    • Purity assessment: Confirmation of protein integrity and absence of contaminating proteins

    • Tag interference control: Comparison with untagged protein when possible

  • Experimental system controls:

    • Empty vector controls in transfection experiments

    • Wild-type versus knockout/knockdown comparisons

    • System-specific controls: When using different cell types or in vitro systems

  • Technical controls:

    • Randomization of experimental units

    • Blinding of analysis where applicable

    • Replication across independent experiments

These controls are essential for distinguishing CG5382-specific effects from experimental artifacts, particularly given the complex metal-dependent nature of its function .

How can researchers effectively compare DNA binding profiles of CG5382 across different experimental conditions?

Comparing DNA binding profiles of CG5382 across experimental conditions requires specialized analytical approaches :

  • Standardized binding metrics: Establish consistent quantitative measures of binding affinity (Kd values) and kinetics (kon/koff rates) that can be compared across experiments .

  • Reference sequence normalization: Express binding to experimental sequences relative to a consistent reference sequence to control for batch effects and experimental variation .

  • Comprehensive binding site analysis: Characterize binding to various metal-responsive element (MRE) variants to develop a complete binding site preference profile .

  • Competition assays: Implement competitive binding experiments to directly compare relative affinities under identical conditions .

  • Integrated data visualization: Develop standardized visualization approaches (e.g., heatmaps of binding across conditions, sequence logos for position weight matrices) that facilitate direct comparison .

When analyzing CG5382 binding data, researchers should consider that while the protein requires zinc for DNA binding (similar to mammalian MTF-1), its transcriptional activation profile differs significantly in response to other metals, necessitating careful distinction between binding capability and transcriptional output .

What are the most promising future research directions for CG5382 studies?

Based on current knowledge gaps and emerging techniques, several research directions offer particular promise :

  • Structural biology approaches: Determine the three-dimensional structure of CG5382, particularly focusing on metal-binding sites and interactions with DNA.

  • Interactome mapping: Identify protein interaction partners that modulate CG5382 activity in different cellular contexts and in response to different metals.

  • Genome-wide binding analysis: Apply ChIP-seq to comprehensively map CG5382 binding sites across the Drosophila genome under different metal stress conditions.

  • Evolutionary functional analysis: Conduct comparative studies across multiple Drosophila species to understand the evolution of metal response systems.

  • System-level metal homeostasis integration: Investigate how CG5382 functions within the broader network of metal transport, storage, and detoxification proteins.

These directions leverage the unique properties of CG5382, particularly its distinct metal response profile compared to mammalian homologs, to advance understanding of metal-responsive transcriptional regulation across species .

How can contradictory findings in metal response studies be reconciled through improved experimental design?

Resolving contradictions in metal response studies requires systematic improvements to experimental design :

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.