Recombinant Drosophila miranda Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila miranda (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprised of three multi-subunit complexes (succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV)), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

What is the functional role of mt:CoII in Drosophila miranda cytochrome c oxidase (COX)?

Methodological Answer: mt:CoII (Cytochrome c oxidase subunit 2) is a mitochondrial DNA-encoded core subunit of COX, responsible for electron transfer from cytochrome c to the catalytic heme a₃-CuB center. Its structural homology to D. melanogaster COXII includes:

  • A conserved transmembrane domain critical for proton channeling.

  • A CuA-binding site (residues 151–229) essential for redox activity .

Key experimental validation steps:

  • Knockdown (KD) assays: RNAi targeting mt:CoII in D. miranda cell lines reduces COX activity by ~55% (similar to D. melanogaster CG7630 KD models ).

  • BN-PAGE analysis: Solubilize mitochondria with n-dodecyl-β-D-maltoside (DDM) and assess COX assembly via in-gel activity assays .

  • Co-immunoprecipitation: Confirm physical interaction with COX4 using HA-tagged mt:CoII constructs .

How is recombinant mt:CoII expressed and purified for structural studies?

Methodological Answer: Recombinant mt:CoII is typically expressed in E. coli with a C-terminal His tag (e.g., pProEX HT vector) and purified via immobilized metal affinity chromatography (IMAC).

ParameterDetails
Expression systemE. coli BL21(DE3)
VectorpcDNA3.1+/C-(K)DYK or custom vectors
Codon optimizationRequired for AT-rich mitochondrial genes
Purification bufferTris-based buffer (pH 8.0) with 50% glycerol for stability
Yield~1–2 mg/L culture (lyophilized)

Critical considerations:

  • Use protease inhibitors during lysis to prevent degradation of the hydrophobic transmembrane domain.

  • Validate folding via circular dichroism (CD) spectroscopy or redox activity assays .

Advanced Research Questions

How can structural discrepancies between predicted and observed mt:CoII conformations be resolved?

Methodological Answer: Discrepancies often arise from post-translational modifications (PTMs) or incomplete membrane integration.

Strategies:

  • Cryo-EM with nanodiscs: Embed recombinant mt:CoII in lipid bilayers to preserve native conformation .

  • Molecular dynamics (MD) simulations: Compare predicted (AlphaFold) vs. experimental structures (PDB) using tools like GROMACS .

  • Mass spectrometry: Identify PTMs (e.g., phosphorylation at Ser-45) that alter electrophoretic mobility .

Example data conflict:

  • Predicted molecular weight: 25.8 kDa (229 aa).

  • Observed SDS-PAGE migration: ~30 kDa due to glycosylation .

What methodologies optimize redox property analysis of mt:CoII in vitro?

Methodological Answer: Use a combination of spectroscopic and electrochemical assays:

TechniqueApplication
UV-Vis spectroscopyDetect CuA center absorption at 480 nm and 530 nm
Electron paramagnetic resonance (EPR)Quantify Cu²⁺ redox states in oxidized/reduced conditions
Cyclic voltammetryMeasure midpoint potential (Em) of CuA (~250 mV vs. SHE)

Troubleshooting:

  • Avoid O₂ exposure during sample preparation to prevent artificial oxidation.

  • Use anaerobic chambers for redox titration .

How do mutations in mt:CoII affect COX assembly and organismal fitness?

Methodological Answer:

  • Site-directed mutagenesis: Introduce patient-derived mutations (e.g., G177S) into recombinant mt:CoII .

  • Functional complementation: Express mutant mt:CoII in D. miranda COX-deficient models and assess:

    • Larval development (e.g., pupation rate).

    • ATP synthesis (luciferase-based assays) .

    • Reactive oxygen species (ROS) levels (DCFDA fluorescence) .

Key finding in homologs:

  • D. melanogaster COXII G177S reduces COX activity by 20% and causes male sterility .

Data Contradiction Analysis

Why do some studies report mt:CoII as non-essential despite its role in COX?

Methodological Context:

  • Tissue-specific redundancy: mt:CoII knockdown in D. melanogaster neurons causes severe defects, but muscle cells show compensatory upregulation of alternative oxidases (AOX) .

  • Threshold effect: >70% COX activity loss is required for phenotypic manifestation .

Resolution strategy:

  • Use tissue-specific drivers (e.g., elav-Gal4 for neurons) to bypass systemic compensation .

  • Combine RNAi with AOX inhibition (e.g., SHAM) to unmask mt:CoII dependency .

Comparative Table: mt:CoII Orthologs Across Species

SpeciesIdentity (%)Key Functional MotifsPhenotype of Knockout
D. miranda100CuA-binding (H161, C200, C204)Larval lethality (Stage III)
D. melanogaster89Transmembrane helix (residues 50–70)Male sterility, reduced lifespan
Homo sapiens76D-pathway (D132, K136) for proton transferLeigh syndrome, encephalopathy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.