Recombinant Drosophila mojavensis Protein wntless (wls)

Shipped with Ice Packs
In Stock

Description

Biological Role in Wnt Secretion

Wntless (Wls) is indispensable for Wnt protein secretion:

  • Mechanism: Acts as a cargo receptor, shuttling Wnt proteins from the Golgi to the plasma membrane. Post-secretion, Wls is internalized and recycled back to the Golgi via the retromer complex (Vps35/Vps26) .

  • Conservation: Functional homologs exist in C. elegans (MIG-14), mice (Gpr177), and humans, underscoring its evolutionary importance .

  • Specificity: Required for all Wnts except WntD, which bypasses Wls-mediated secretion .

3.1. Functional Studies

Recombinant Wls enables:

  • In vitro secretion assays: Reconstitution of Wnt transport mechanisms using cultured cells .

  • Interaction mapping: Identification of binding partners (e.g., retromer components, Porcupine acyltransferase) .

  • Structural analysis: Investigation of transmembrane topology and lipid-binding domains .

3.2. Disease Models

  • Cancer: Dysregulated Wnt secretion is linked to tumor progression; recombinant Wls aids in screening for inhibitors .

  • Neurodevelopmental disorders: Wls-containing exosomes mediate synaptic Wnt signaling, relevant in neuronal connectivity studies .

Key Research Findings

StudyInsightSource
Retromer dependencyWls recycling to the Golgi requires Vps35; loss causes lysosomal degradation .
Lipid modificationPorcupine-mediated palmitoylation of Wnts is essential for Wls binding .
ER stress inductionImpaired Wls function traps Wnts in the ER, triggering unfolded protein response .

Future Directions

  • Therapeutic targeting: Small-molecule inhibitors of Wls-Wnt interactions could modulate aberrant Wnt signaling in cancers .

  • Cryo-EM studies: High-resolution structural analysis of Wls in complex with Wnt ligands .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, kindly indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice packaging is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
wls; GI11620; Protein wntless
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-562
Protein Length
Full Length of Mature Protein
Species
Drosophila mojavensis (Fruit fly)
Target Names
wls
Target Protein Sequence
FLIGGLYAPVPAGHQIVMGIKCRDVAGRQNDTSFFLYSRGNGACDSVQDIDIEQDPLKMA NQLVYVFQMPLPRDNRTLDYSRWQQNLIGVLQMDIAYDSSSELREPPKELQLTIDTRLAY RNKNDEDADWKPYAHSIEKRFLDCRAAHVGLQEILYTCDIIPLFELGALHHSFYLLNLRF PMDTPKRLNLQFGHMHDIILTAIHQNGGFTQVWLLLKSVLFPFIIGIMVWFWRRVHILQR SPALLEYMLLYLGGALSFLNLPLEYLTLSFEMPYMLLLSDVRQGIFYAMLLSFWLVFAGE HMLIQDSPNKSTIRSRYWKHLSAVVVGCISLFVFDICERGMQLRNPFYSIWTTPLGAKVA MSFIVLAGVSAGIYFLFLCYMVWKVFKDIGDKRTSLPSMSQARRLHYEGLIYRFKFLMLA TLLCAGLTVAGFIMGQMAEGHWKWNEDIEIQLTSAFLTGVYGMWNIYIFALLILYAPSHK QWPTMRHSDETTQSNENIVASAASEEIEFSNLPSDSNPSEISSLTSFTRKVAFD
Uniprot No.

Target Background

Function
Wntless (Wls) is a segment polarity gene crucial for wingless (wg)-dependent patterning processes. Its role extends to both wg-sending and wg-target cells. In non-neuronal cells, Wls facilitates the secretion of wg. The Wls trafficking loop encompasses the Golgi, the cell surface, an endocytic compartment, and a retrograde route leading back to the Golgi. This process involves clathrin-mediated endocytosis and the retromer complex (a conserved protein complex consisting of Vps35 and Vps26). In neuronal cells (specifically, the larval motorneuron NMJ), the wg signal transits the synapse via the release of Wls-containing exosome-like vesicles. Postsynaptic Wls is essential for the trafficking of fz2 through the fz2-interacting protein Grip.
Database Links
Protein Families
Wntless family
Subcellular Location
Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodologies are most effective for studying Wntless trafficking in Drosophila cells?

Several methodologies have proven effective for studying Wntless trafficking in Drosophila cells:

Pulse-Chase Assays with Antibody Labeling:

  • Label extracellular Wg protein with primary antibody on ice

  • Allow short pulse of internalization at 30°C

  • Remove unbound antibody with ice-cold acidic buffer wash

  • Perform chase at 25°C for various time intervals (e.g., 10 minutes)

  • Analyze colocalization with endosomal markers

Expression of Tagged Rab Proteins:

  • Use temperature-sensitive Gal4 system to express Rab5 CA-YFP

  • Shift larvae from 18°C (to block Gal4 activity) to 29°C for 6 hours

  • Observe enlarged endosomes containing Wg and Evi

  • Track colocalization using confocal microscopy

Antibody-Based Differentiation of Free vs. Bound Wntless:

  • Use antibodies against the extracellular domain (ECD) of Evi/Wls to specifically label the Wnt-unbound ("free") Evi

  • Use antibodies against the C-terminal domain (CTD) to label total Evi population

  • Compare distribution patterns to determine where dissociation occurs

MethodologyApplicationAdvantagesLimitations
Pulse-ChaseTracking internalization and traffickingTemporal resolution of trafficking eventsLabor intensive; limited to accessible tissues
Rab Protein ExpressionVisualization of endosomal compartmentsCreates enlarged endosomes for easier visualizationPotential artifacts from overexpression
Domain-Specific AntibodiesDistinguishing free vs. Wnt-bound WntlessDirect evidence of dissociation eventsRequires specific antibodies; potential accessibility issues
Genetic ManipulationTesting functional requirementsReveals in vivo significancePotential developmental defects may complicate analysis
  • How does Ehbp1 regulate Wntless-dependent Wnt trafficking in polarized cells?

Ehbp1 has been identified as a crucial switch that dictates the direction of Wg/Wnt polarized intracellular transport in Drosophila larval wing disc epithelium. The mechanism operates as follows:

  • The Adaptor Protein complex 1 (AP-1) normally delivers Wg/Wnt to the basolateral cell surface

  • Ehbp1 sequesters AP-1, redirecting Wg/Wnt for apical delivery

  • Ehbp1 specifically regulates the polarized distribution of Wg/Wnt, in a process dependent on Wntless

  • Mechanistically, Ehbp1 competes with Wntless for AP-1 binding, preventing unregulated basolateral Wg/Wnt transport

When Ehbp1 expression is reduced or when the coiled-coil motifs within its bMERB domain are removed, Wg/Wnt accumulates basolaterally. This regulatory mechanism appears to be conserved in vertebrates as demonstrated in MDCK cells with WNT7A .

Experimental evidence supporting this model:

  • Genetic analyses showed that Ehbp1 specifically regulates polarized Wg/Wnt distribution

  • Knockdown of EHBP1 in MDCK cells leads to basolateral accumulation of WNT7A

  • Simultaneous suppression of WLS and EHBP1 produces phenotypes similar to WLS knockdown alone

  • Suppression of AP-1 μ1A results in intracellular enrichment of WNT7A and reduced basolateral secretion

  • Where and how does dissociation of the Wntless-Wnt complex occur during trafficking?

Recent research using Drosophila wing epithelium has traced the route of the Evi-Wg complex leading up to their separation. The findings reveal:

  • The Evi-Wg complex is internalized from the apical surface of polarized cells

  • Evi and Wg separation occurs post-internalization in acidic endosomes

  • The process can be tracked using antibodies that specifically label the Wnt-unbound Evi

The evidence comes from multiple experimental approaches:

  • Pulse-chase assays showing internalized Wg colocalizing with early endosomal marker Rab5 in both producing and receiving cells

  • Expression of constitutively active Rab5 (Rab5 CA-YFP) creating enlarged endosomes that accumulate both Wg and Evi

  • Analysis of "free" Evi using domain-specific antibodies showing that dissociation occurs in these endosomal compartments

  • Studies in cells with Vps34 loss showing enhanced dissociation of Evi and Wg in enlarged late endosomes marked by Rab7

This research refines our understanding of polarized trafficking of Wg and highlights the importance of Wg endocytosis in its secondary secretion.

  • What experimental approaches can be used to study cross-species conservation of Wntless function?

To study the evolutionary conservation of Wntless function across species, researchers have employed several experimental approaches:

Comparative Functional Analysis:

  • Testing Wls function in multiple model organisms (Drosophila, C. elegans, human cells)

  • Demonstrating that Wls is required for Wingless-dependent processes in Drosophila, MOM-2-governed polarization in C. elegans, and Wnt3a-mediated communication in human cells

Rescue Experiments:

  • Expressing Wls from one species in mutants of another species to test functional conservation

  • Observing whether cross-species expression can rescue loss-of-function phenotypes

Structural Conservation Analysis:

  • Comparing amino acid sequences and protein domains across species

  • Identifying conserved motifs that are essential for function

Cell-Based Trafficking Assays:

  • Using MDCK cells to study the regulation of polarized WNT7A delivery by EHBP1

  • Comparing trafficking mechanisms between Drosophila and vertebrate systems

Evidence from these approaches suggests that the Wntless function is highly conserved across evolutionary distance, with similar mechanisms operating in insects and vertebrates. The regulation of polarized Wnt delivery by EHBP1 appears to be conserved from flies to vertebrates, though some species-specific differences in trafficking machinery may exist .

  • What are the current technical challenges in expressing and purifying recombinant Wntless protein?

The expression and purification of recombinant Wntless protein from Drosophila mojavensis presents several technical challenges:

Membrane Protein Solubilization:

  • Wntless is a multi-pass transmembrane protein, making it difficult to solubilize while maintaining native conformation

  • Requires careful optimization of detergent types and concentrations

Post-Translational Modifications:

  • Proper folding and function may depend on specific modifications not reproduced in all expression systems

  • Selection of appropriate expression system is critical

Protein Stability:

  • Recombinant Wntless requires specific storage conditions (typically -20°C, with 50% glycerol in Tris-based buffer)

  • Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week

Expression Systems:

  • Drosophila Schneider S2 cells provide a homologous system for expression

  • Alternative systems include HEK293T cells for mammalian expression, with subsequent purification techniques

For researchers working with recombinant Drosophila mojavensis Wntless, the recommended storage and handling procedures include:

  • Store at -20°C, or at -80°C for extended storage

  • Use 50% glycerol in optimized Tris-based buffer

  • Avoid repeated freeze-thaw cycles

  • Prepare working aliquots to be stored at 4°C for up to one week

  • How can genetic approaches in Drosophila advance our understanding of Wntless-dependent Wnt trafficking?

Genetic approaches in Drosophila provide powerful tools for understanding Wntless-dependent Wnt trafficking:

Loss-of-Function Analysis:

  • Multiple alleles of Wntless/Evi have been characterized in Drosophila

  • Phenotypic analysis reveals the role of Wntless in developmental processes

  • Wing disc models show that loss of Wntless leads to defects in Wingless secretion and signaling

Genetic Interaction Studies:

  • Analysis of double mutants for wg and DWnt2 reveals redundant functions in tracheal development

  • When both genes are removed together, phenotypes resemble those observed when the entire Wnt pathway is shut down

Tissue-Specific Manipulation:

  • GAL4-UAS system allows for targeted expression or knockdown in specific tissues

  • Temperature-sensitive Gal4 enables temporal control of gene expression

  • Example: expressing Rab5 CA-YFP in larvae reared at 18°C then shifted to 29°C for 6 hours

Domain-Specific Mutations:

  • Creating mutations in specific domains of Wntless can reveal their functional importance

  • Example: removing coiled-coil motifs within the bMERB domain of Ehbp1 leads to basolateral Wg/Wnt accumulation

Such genetic approaches in Drosophila have revealed that Wntless functions specifically in Wnt secretion, with no effect on other signaling pathways, and that it appears to be an ancient partner for Wnts dedicated to promoting their secretion into the extracellular environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.