Recombinant Drosophila mojavensis Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant Drosophila mojavensis Spastin is classified enzymatically as EC 3.6.4.3, identifying it as a hydrolase that acts on acid anhydrides to facilitate ATP-dependent microtubule severing. The protein is encoded by the spas gene and is referenced in protein databases under UniProt accession number B4K799 . Commercial preparations of this recombinant protein are typically produced in yeast expression systems and purified to >85% homogeneity as determined by SDS-PAGE analysis .

Microtubule Severing Mechanism

Spastin functions as a hexameric ring-shaped ATPase that severs microtubules along their lengths. This severing activity is distinct from the well-characterized disassembly mechanism of dynamic instability, which occurs spontaneously only at microtubule ends . The binding of spastin to microtubule polymers promotes its hexamerization and subsequent ATP hydrolysis, leading to the breakage of the microtubule substrate . This activity is crucial for regulating microtubule dynamics in neurons, particularly at synapses and within axons.

Neurodevelopmental Research Models

Drosophila has been successfully used as an in vivo model system to investigate spastin's functional role in regulating neuromuscular junction (NMJ) development and activity . Recombinant Drosophila mojavensis Spastin provides researchers with a valuable tool for comparative studies across Drosophila species, potentially revealing evolutionary adaptations in microtubule regulation.

Studies utilizing Drosophila models have demonstrated that spastin loss causes alterations in synaptic development of NMJs and defects in neurotransmission. These morphological and functional defects are associated with aberrant stabilization of the microtubule cytoskeleton at the pre-synapse . Different experimental approaches, including RNAi-mediated downregulation and expression of spastin missense mutations, have shown varying effects on NMJ development:

  1. RNAi-mediated reduction of spastin and expression of missense mutations lead to undergrowth of NMJ and specific reduction in synaptic area .

  2. Complete loss of spastin in null alleles results in increased bouton numbers and formation of abnormal grape-like clusters, linked to the absence of distal microtubules .

Human Disease Modeling

Mutations in human spastin (SPG4) represent the most common cause of autosomal dominant hereditary spastic paraplegia (AD-HSP), a neurodegenerative disorder characterized by progressive spasticity and weakness of the lower limbs . The functional conservation between Drosophila and human spastin makes Drosophila models, including those using recombinant Drosophila mojavensis Spastin, valuable for studying disease mechanisms.

Research has shown that specific mutations in the spastin AAA domain, such as the K388R substitution (equivalent to human K388R), cause complete loss of ATPase and microtubule severing activity in vitro . These findings have helped elucidate how disease-causing mutations might lead to pathology through either dominant-negative mechanisms or haploinsufficiency.

Therapeutic Potential

Recent research has identified potential therapeutic targets for spastin-related disorders. For instance, studies have shown that downregulation or chemical inhibition of CRL4, a regulator of spastin protein levels, can induce recovery of spastin levels and reduce HSP-associated phenotypes in Drosophila models of SPG4 haploinsufficiency and patient-derived cells . These findings suggest that manipulating spastin levels or activity could have therapeutic implications for human neurological disorders.

Expression and Purification

Recombinant Drosophila mojavensis Spastin is typically produced using yeast expression systems, which provide appropriate post-translational modifications while maintaining high protein yields . Purification generally involves affinity chromatography, with the specific tag type determined during the production process to optimize protein folding and activity .

Experimental Applications Protocol Considerations

When utilizing recombinant Drosophila mojavensis Spastin in experimental settings, several technical considerations should be addressed:

Table 3: Experimental Considerations for Recombinant D. mojavensis Spastin Use

ApplicationRecommended ConcentrationBuffer ConditionsSpecial Considerations
Microtubule Severing Assays50-500 nM20 mM HEPES pH 7.0, 1 mM MgCl₂, 1 mM ATPInclude ATP regeneration system
ATPase Activity Assays100-200 nM50 mM Tris-HCl pH 7.5, 20 mM KCl, 10 mM MgCl₂Monitor phosphate release
Cell Culture Studies1-5 μg/mLCell culture mediumConsider transfection efficiency
Structural Studies1-10 mg/mLProtein-specific bufferRemove glycerol before crystallization

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
spas; GI24145; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-765
Protein Length
full length protein
Species
Drosophila mojavensis (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSTKSPVKISGGGSSGANRSRSCSEALIDDGKTSSKLSSNRQRATI TTTTTSTTPGSSPDDDTTDADLTPTSGYGPRGGTSVHKQNLYVVSFPIIFLFNVLRSLIY QLFCIFRYLYCASTKVIYRSPHRRDCNIEIVVQNSKEQQSIICPLERNTSDGIEKAQQLL PQRQRALLPLEMATNRGGSGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKE LAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHEKMQTNLSMARDRLHFLALREEDL QMQRLSLMDPPKNKQQVTSKFKQPMLVGQTNSKAAAVEPSKITMRSSGYGPKPVSGTGSS AGTSKALQAASGRKLTIGNKRPGNLAVANKSQTLPRNLGSKTTSTSVGAALQRQPGKTAA TPPAVRRQFSSGRNTPPQRSRTPINNNAASGSGSGSGASTPMISVKGVEQKLVQLIMDEI VEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLA RAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHLQPSIIFIDEVDSLLSERSS NEHEASRRLKTEFLVEFDGLPGNPEGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPEV QTRELLLSRLLQKQGSPLDTEALARLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKC LDISAMRPITEKDFHNSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
ATP-dependent microtubule severing protein. Stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability in the neuromuscular junction synapse. Involved in lipid metabolism by regulating the size and distribution of lipid droplets. Involved in axon regeneration by regulating microtubule severing.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.