Recombinant Drosophila narragansett Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila narragansett (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNIEFDS YMIPTNELANDGFRLLDVDNRIILPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt:CoII) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that powers ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Drosophila narragansett Cytochrome c oxidase subunit 2 (mt:CoII) and what is its significance in research?

Recombinant Drosophila narragansett Cytochrome c oxidase subunit 2 (mt:CoII) is a partial recombinant protein derived from the fruit fly Drosophila narragansett. It represents the second subunit of cytochrome c oxidase (COX), which functions as the terminal oxidase in the mitochondrial respiratory chain with an EC classification of 1.9.3.1. This protein is significant for research in evolutionary biology, mitochondrial function, and comparative studies of respiratory chain components across Drosophila species .

The protein's research value stems from:

  • Its role in electron transport and cellular respiration

  • Its encoding in mitochondrial DNA, making it valuable for studies of mitochondrial inheritance and evolution

  • The conservation of cytochrome c oxidase function across species, enabling comparative functional studies

  • Its potential role in male fertility and sperm development in Drosophila species

How is Recombinant Drosophila narragansett Cytochrome c oxidase subunit 2 typically produced for research purposes?

Production of recombinant mt:CoII typically follows these methodological steps:

  • Expression system selection: Most commonly expressed in E. coli as indicated in product specifications

  • Gene synthesis and cloning: The partial mt:CoII gene sequence is optimized for the expression system and cloned into an appropriate vector

  • Protein expression: Induced expression in the bacterial host under optimized conditions

  • Purification: Typically through affinity chromatography using an added tag (tag type is determined during the manufacturing process)

  • Quality control: Product purity is verified through SDS-PAGE analysis (typically >85% purity)

  • Storage preparation: The recombinant protein is prepared in buffer with glycerol (typically 50% final concentration) for long-term stability

Researchers should note that the protein may be supplied in either liquid form (with 6-month shelf life at -20°C/-80°C) or lyophilized form (with 12-month shelf life at -20°C/-80°C) .

What are the proper storage and handling procedures for recombinant mt:CoII to maintain its stability and activity?

Proper storage and handling are critical for maintaining protein integrity:

Storage conditions:

  • Store at -20°C or -80°C for long-term preservation

  • Liquid formulations have a shelf life of approximately 6 months

  • Lyophilized formulations have a longer shelf life of up to 12 months

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) to prevent freeze-thaw damage

Handling precautions:

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein stability

  • For short-term use, store working aliquots at 4°C for up to one week

  • Prepare single-use aliquots to minimize freeze-thaw cycles

How is the CO1 gene used to study genetic diversity among Drosophila species, and what methodological approaches are most effective?

The cytochrome c oxidase subunit 1 (CO1) gene serves as an important genetic marker for studying diversity in Drosophila species. Effective methodological approaches include:

Sample collection strategy:
Regional sampling across geographic distributions is critical for comprehensive analysis. As demonstrated in North Sulawesi research, samples from six distinct districts (Central Minahasa, Southeast Minahasa, South Minahasa, North Minahasa, Bolaang Mongondow, and Sitaro) revealed significant genetic diversity .

DNA extraction and sequencing approach:

  • Extract DNA from thoracic tissue of fruit fly samples

  • Amplify the CO1 gene using polymerase chain reaction (PCR)

  • Sequence using the Sanger method

  • Analyze sequences using bioinformatics tools such as BioEdit and MEGA XI programs

Analytical methods:

  • Sequence consensus analysis: Research shows CO1 gene sequence lengths typically range from 688 bp to 700 bp in Drosophila

  • Divergent evolution assessment through disparity analysis

  • Genetic distance calculations between populations

  • Consensus alignment analysis with ClustalW to identify genetic variations

  • Phylogenetic reconstruction to establish evolutionary relationships

Data from North Sulawesi shows high genetic variation in CO1 genes, with Bolaang populations showing the greatest genetic distance and sequence characteristic differences from other regional populations .

What evidence supports homologous recombination in Drosophila mitochondrial DNA, and what experimental designs can detect and measure it?

Evidence for mitochondrial DNA recombination in Drosophila comes from several experimental approaches:

Key evidence supporting mtDNA recombination:

  • Selection-based experiments have isolated recombinant mitochondrial genomes that became the sole or dominant genome in progeny under specific selective conditions

  • Double-strand breaks have been shown to enhance recombination in both germline and somatic tissues

  • Long continuous stretches of exchange have been documented when recombination occurs between diverged Drosophila melanogaster genomes or between different species (e.g., D. melanogaster and D. yakuba)

Experimental designs to detect recombination:

  • Heteroplasmic selection approach:

    • Create heteroplasmic lines carrying two distinct mitochondrial genomes

    • Apply selective pressure that favors recombinant genotypes

    • Example: Selection for temperature tolerance in lines carrying both temperature-sensitive and wild-type mitochondrial genomes

  • Double-strand break induction:

    • Express mitochondrially-targeted restriction enzymes (e.g., mito-BglII and mito-XhoI)

    • Design enzyme targeting to cut specific mtDNA sequences

    • This approach vastly increases homologous recombination rates in heteroplasmic lines

  • Detection methods:

    • Southern blot analysis to track the presence of parental and recombinant genomes

    • PCR-based detection of recombination junctions

    • DNA sequencing to characterize recombination breakpoints and confirm recombinant sequences

One particularly effective experimental design involved expressing both mito-BglII and mito-XhoI enzymes in the germline, which cuts either parental genome but allows survival of recombinant genomes carrying resistance markers from both parents .

How does the mt:CoII G177S mutation specifically impact male fertility in Drosophila, and what experimental approaches demonstrate this relationship?

The mt:CoII G177S mutation represents a hypomorphic variant of cytochrome oxidase II that specifically impairs male fertility in Drosophila melanogaster without affecting other male or female functions.

Experimental evidence of male-specific effects:

Research has demonstrated the following characteristics of this mutation:

  • Age and temperature-dependent decrease in male fertility

  • Correlation between fertility decrease and reduction in COII enzymatic activity

  • No detectable defects in other male or female phenotypic traits

  • Cellular characterization reveals decreased sperm production and function specifically in mutant males

Experimental approaches to demonstrate the relationship:

  • Fertility assays:

    • Quantitative measurement of egg hatching rates when females are mated with wild-type versus COII G177S males

    • Results show significantly reduced hatching rates specifically with mutant males

  • Enzymatic activity measurements:

    • Direct assessment of COII activity in isolated mitochondria from mutant versus wild-type flies

    • Demonstrates specific reduction in activity correlating with fertility defects

  • Cellular characterization:

    • Immunofluorescence staining of testes

    • Confocal microscopy of unfixed seminal vesicles using Mitotracker Green and Mitotracker CMXRos

    • Analysis of sperm morphology and function through imaging of sperm extruded from seminal vesicles

  • Genetic rescue experiments:

    • Testing suppression of fertility defects across diverse nuclear genetic backgrounds

    • Demonstrating that certain D. melanogaster nuclear backgrounds can fully rescue COII G177S-associated sterility

The specificity of this mtDNA mutation to male fertility makes it one of the clearest examples of a "male-harming" mtDNA mutation in animals, consistent with the Mother's Curse hypothesis regarding the accumulation of male-harming mtDNA mutations due to strict maternal inheritance .

What role does cytochrome c play in apoptosis in Drosophila, and how does this differ from its role in mammals?

The role of cytochrome c in apoptosis represents an area of significant difference between Drosophila and mammalian systems:

Mammalian systems:

  • Cytochrome c release from mitochondria is a key step in apoptosis

  • Upon release, cytochrome c binds to Apaf-1, promoting apoptosome formation and caspase activation

Drosophila system - contrasting evidence:

  • Arguments against cytochrome c role in Drosophila apoptosis:

    • RNAi experiments in Drosophila S2 cells failed to reveal a role for cytochrome c in apoptosis

    • Silencing expression of either or both DC3 (Cytc-d) and DC4 (Cytc-p) had no effect on apoptosis or activation of DRONC and DRICE in Drosophila cells

    • Loss of function mutations in dc3 and dc4 do not affect caspase activation during Drosophila development

    • Ectopic expression of DC3 or DC4 in Drosophila cells does not induce caspase activation

    • Recombinant DC3 or DC4 failed to activate caspases in Drosophila cell lysates

  • Arguments supporting cytochrome c role in Drosophila apoptosis:

    • Drosophila contains an Apaf-1 isoform with a WD40 repeat domain that can bind cytochrome c in vitro

    • This isoform can promote cytochrome c-dependent caspase activation in lysates from developing embryos

    • Alteration in cytochrome c immuno-staining can be detected in doomed cells in some Drosophila tissues

    • Mitochondria from apoptotic cells can activate cytosolic caspases

    • Disruption of cyt-c-d is associated with failure to activate caspases during sperm terminal differentiation

  • Experimental evidence for tissue-specific roles:

    • Cytochrome c-d is required for caspase activation during spermatid individualization

    • Transgenic expression of cyt-c-d restores effector caspase activation in cyt-c-d mutant spermatids

    • Both cyt-c-d and cyt-c-p proteins are functionally equivalent in restoring caspase activation

An interesting experimental finding is that recombinant DC3 or DC4 failed to activate caspases in Drosophila cell lysates but remarkably induced caspase activation in extracts from human cells, highlighting fundamental differences in apoptotic mechanisms .

How does cytochrome c oxidase deficiency affect cellular homeostasis of transition metals in Drosophila melanogaster?

Cytochrome c oxidase (COX) deficiency in Drosophila melanogaster significantly impacts cellular metal homeostasis, particularly affecting copper, iron, manganese, and zinc distribution:

Key findings on metal homeostasis disruption:

  • Copper distribution changes:

    • Decreased copper content in the mitochondria

    • Various degrees of increased copper in the cytosol

    • These changes suggest impaired incorporation of copper into COX

  • Effects on other metals:

    • Changes in levels of cytosolic and/or mitochondrial iron

    • Alterations in manganese distribution

    • Particularly pronounced changes in zinc levels across several COX-deficient models

  • Transcriptional responses:

    • Decreased expression of copper transporters

    • Increased expression of other metal-handling genes

    • These compensatory transcriptional changes suggest cellular attempts to restore homeostasis

Experimental approaches used:

The research induced COX deficiency in Drosophila through:

  • Downregulated expression of three different assembly factors

  • Downregulation of one structural subunit

  • These different models allowed comparison of metal homeostasis changes across various mechanisms of COX deficiency

This research demonstrates the broader metabolic consequences of mitochondrial respiratory chain defects, extending beyond energy production to disturb metal homeostasis, with potential implications for understanding mitochondrial disease pathophysiology .

What are the methodological challenges in studying mitochondrial recombination in Drosophila, and how can researchers overcome them?

Studying mitochondrial recombination presents several methodological challenges that researchers must address:

Challenge 1: Low natural recombination rates

  • Natural mtDNA recombination events occur at frequencies too low for routine detection

  • Solution: Design experimental evolution strategies that create permissive conditions for recombination:

    • Prevent females from mating with male siblings

    • Mate virgin females to naïve males from external stock every generation

    • This eliminates indirect selection against male-harming mtDNA mutations

Challenge 2: Distinguishing recombination from heteroplasmy

  • Heteroplasmic mtDNA populations can complicate identification of true recombination events

  • Solution: Use high-fidelity sequencing approaches:

    • Implement Duplex Sequencing strategy followed by hybrid capture

    • Sequence mtDNA at very high depth of coverage (>7000 reads)

    • Label individual DNA molecules and sequence each multiple times

    • This distinguishes true mutations/recombinations from sequencing errors

Challenge 3: Difficulty inducing recombination for study

  • Solution: Implement targeted approaches to increase recombination:

    • Express mitochondrially-targeted restriction enzymes to create double-strand breaks

    • Combine with heteroplasmic lines carrying distinct mtDNA markers

    • This strategy vastly increases homologous recombination rates

Challenge 4: Increasing mutation rates to improve experimental sampling

  • Solution: Consider these approaches:

    • Employ mutator mtDNA polymerase before initiating experimental evolution

    • Apply random chemical mutagenesis followed by backcrossing to replace mutated nuclear genes

    • Combine crossing schemes with targeted restriction endonuclease strategies

Challenge 5: Confirming homoplasmy/heteroplasmy status

  • Solution: Sequence individual flies to high depth of coverage

    • In one study, 7 individual flies were sequenced from a Drosophila pool

    • 6 flies showed no wildtype mtDNA reads out of >8,000

    • 1 fly showed 7 wildtype reads out of >11,000 (<0.1%)

How can researchers resolve contradictory findings regarding the role of cytochrome c in Drosophila apoptosis?

The role of cytochrome c in Drosophila apoptosis remains controversial, with contradictory findings in the literature that require methodological approaches to resolve:

Sources of contradictory findings:

  • Different experimental systems and contexts:

    • Cell line studies (S2 cells) versus whole organism/tissue studies

    • Different developmental stages and tissues examined

    • Varied approaches to interfering with cytochrome c function

  • Possible tissue-specific roles:

    • Evidence suggests cytochrome c-d is required for caspase activation in spermatid individualization

    • But may not be required in other tissues or developmental contexts

Methodological approaches to resolve contradictions:

  • Comprehensive genetic analysis:

    • Isolate clean point mutations in cytochrome c genes to avoid effects on neighboring genes

    • Use transgenic rescue experiments to unequivocally establish gene function

    • Example: Studies that isolated a point mutation in cyt-c-d and demonstrated transgenic rescue of effector caspase activation

  • Direct comparative studies:

    • Compare cytochrome c function across different experimental systems

    • Example: The finding that recombinant DC3 or DC4 failed to activate caspases in Drosophila cell lysates but induced caspase activation in human cell extracts

  • Detailed biochemical characterization:

    • Examine the molecular interactions between cytochrome c and potential binding partners

    • Study the ability of different cytochrome c proteins to bind Apaf-1/Ark and influence apoptosome formation

  • Tissue-specific analysis:

    • Perform parallel analyses across multiple tissues and developmental contexts

    • Example: Comparing cyt-c-d expression and function in adult and larval testes versus ovaries

  • Integrated approach examining alternative pathways:

    • Examine interactions with other apoptotic regulators (Ark, Dronc)

    • For example, studies found that despite mutations in Ark (Apaf-1) and Dronc (caspase-9) having similar phenotypes to caspase-activity blocks, some active caspase-3 staining could still be detected, suggesting cytochrome-C-d may function in alternative pathways

What advanced techniques can researchers use to study the relationship between mitochondrial organization and caspase activation during Drosophila sperm development?

Advanced techniques for studying mitochondrial organization and caspase activation during Drosophila spermatogenesis include:

Imaging and microscopy techniques:

  • Confocal microscopy with live mitochondrial staining:

    • Use of dual-staining approaches with Mitotracker Green and Mitotracker CMXRos

    • Dissection of unfixed seminal vesicles in PBS

    • Extrusion of sperm using tungsten needles

    • Immediate imaging to minimize hypoxia effects

    • Capture of both still images and movies using high-speed confocal systems (e.g., resonant scanner on Leica SP5)

  • Immunofluorescence approaches:

    • Fixation of dissected testes in 4% formaldehyde in PBS (30-60 min)

    • Washing in PBS-T (PBS containing 0.1% Triton-X) for at least 30 min

    • Mounting in medium with DAPI for nuclear visualization

    • Imaging on confocal microscopy systems

Molecular and genetic techniques:

  • Gene expression analysis:

    • Comparative RT-PCR analysis of tissues (e.g., adult testes versus ovaries)

    • In situ hybridization to visualize spatial expression patterns

    • Example: Characterization showing cyt-c-d mRNA accumulates before spermatocytes enter meiosis

  • Caspase activity visualization:

    • CM1-staining to visualize activation of apoptotic effector caspases

    • Comparison of staining patterns between wild-type and mutant tissues

  • Genetic manipulation approaches:

    • Transgenic rescue experiments using different cytochrome c genes

    • Creation of mutants affecting spermatid mitochondria

    • Example: Finding that both cyt-c-d and cyt-c-p can restore caspase activation in cyt-c-d deficient spermatids

  • Identification of genetic modifiers:

    • Screening for mutants affecting spermatid mitochondria

    • Analysis of genetic interactions between mitochondrial organization and caspase activation

    • Example: Research has identified several mutants affecting spermatid mitochondria that provide a strong link between mitochondrial organization and caspase activation

This multi-faceted approach allows researchers to establish connections between mitochondrial structure, function, and the activation of caspases during the specialized process of spermatid individualization.

How can researchers design experiments to identify nuclear suppressors of male-harming mtDNA mutations in Drosophila?

Designing experiments to identify nuclear suppressors of male-harming mtDNA mutations requires sophisticated genetic approaches:

Experimental design strategies:

  • Integration of evolutionary principles with functional characterization:

    • Start with well-characterized male-harming mtDNA mutations (e.g., COII G177S)

    • Perform detailed phenotypic analysis to establish clear fertility phenotypes

    • Conduct genetic crosses to test suppression across diverse genetic backgrounds

  • Cross-background fertility testing approach:

    • Cross males carrying the male-harming mtDNA mutation to females from diverse D. melanogaster strains

    • Establish lines with the mtDNA mutation in different nuclear backgrounds

    • Test male fertility across these backgrounds using quantitative fertility assays

    • Example: Testing showed that COII G177S-associated sterility can be completely suppressed by diverse nuclear backgrounds from various D. melanogaster strains

  • Genetic mapping for suppressor identification:

    • Once suppressor backgrounds are identified, perform genetic mapping studies:

      • Create recombinant lines between suppressor and non-suppressor backgrounds

      • Map regions that confer suppression phenotype

      • Utilize genome-wide association studies (GWAS) across multiple backgrounds

  • Fine mapping and candidate gene approach:

    • Use deficiency mapping to narrow suppressor regions

    • Test candidate genes through RNAi knockdown or CRISPR-based approaches

    • Perform transgenic rescue with candidate suppressor genes

  • Mechanistic characterization of suppressors:

    • Measure COII enzymatic activity in suppressed versus non-suppressed backgrounds

    • Examine mitochondrial function and sperm development in detail

    • Investigate molecular interactions between mitochondrial and nuclear gene products

This approach can provide insights into the genetic basis of cyto-nuclear genetic conflict and coevolution, as predicted by theory. Understanding these suppressors may have broader implications for mitochondrial disease and the evolution of separate sexes .

Comparison of Cytochrome c Oxidase Subunit Properties across Drosophila Species

Speciesmt:CoII Gene LengthProtein LengthGenetic Distance*Key Amino Acid VariationsReference
D. narragansettNot specifiedPartial (229 aa)-P67795 (UniProt)
D. melanogaster (N. Sulawesi)688-700 bpNot specified0.0 (reference)Varies by region
D. melanogaster (Bolaang)688-700 bpNot specifiedHighest genetic distanceMost significant differences
D. melanogaster (COII G177S)Not specifiedNot specified-G177S mutation

*Genetic distance relative to reference sequences

Functional Effects of mtDNA Mutations in Drosophila Cytochrome c Oxidase

MutationSpeciesPhenotypic EffectsEnzyme Activity ImpactTissue SpecificityNuclear SuppressionReference
COII G177SD. melanogasterMale fertility defectDecreased COII activitySperm-specificComplete suppression by some nuclear backgrounds
mt:ND2 + del1 mt:CoID. melanogasterTemperature sensitivityCompromised functionNot tissue-specificNot reported
R301Q mt:ND2D. melanogasterUsed as marker for recombination studiesNot specifiedNot specifiedNot applicable

Metal Homeostasis Changes in COX-Deficient Drosophila Models

MetalMitochondrial ContentCytosolic ContentTranscriptional ResponseAffected ProcessesReference
CopperDecreasedIncreased (variable)Decreased copper transporter expressionCOX assembly
IronVariable changesVariable changesNot specifiedRespiratory chain function
ManganeseChanges observedChanges observedNot specifiedAntioxidant defense
ZincPronounced changesPronounced changesIncreased expression of handling genesMultiple cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.